2JS7: PDB entry 2JS7

Solution NMR structure of human myeloid differentiation primary response (MyD88). Northeast Structural Genomics target HR2869A. Determined by solution NMR. Released 23 Oct 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,313
Mol. weight: 18.76 kDa
Released: 23 Oct 2007

Explore 2JS7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JS7 contains 9 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	17-22	6	1
α-helix	25-27	3
α-helix	28-39	12
β-strand	48-49	2	1
α-helix	65-67	3
α-helix	68-71	4
β-strand	72-78	7	1
α-helix	81-85	5
α-helix	87-99	13
α-helix	103-106	4
β-strand	108-112	5	1
α-helix	118-121	4
β-strand	130-131	2	1
α-helix	141-150	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myeloid differentiation primary response protein MyD88	A	protein	160	Homo sapiens	Q99836 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JS7_1 Myeloid differentiation primary response protein MyD88 (chains A)
MGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCV
WSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEF
PSILRFITVCDYTNPCTKSWFWTRLAKALSLPLEHHHHHH

Primary citation

Solution NMR Structure of Human Myeloid Differentiation Primary Response (MyD88). Rossi, P., Xiao, R., Tao, X. et al. To be published.

Other PDB entries of the same protein (UniProt Q99836 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EO7 1.45 Å, Crystal structure of the TIR domain of human myeloid differentiation primary response…
9HFV 1.45 Å, MyD88 peptide_2 bound to SPOP MATH domain
4DOM 1.8 Å, Crystal Structure of the TIR-domain of Human Myeloid Differentiation Primary Response…
9HGH 1.9 Å, MyD88 peptide_1 bound to SPOP MATH domain
7BER 2.3 Å, SFX structure of the MyD88 TIR domain higher-order assembly (solved, rebuilt and refined…
7L6W 2.3 Å, SFX structure of the MyD88 TIR domain higher-order assembly
8S78 2.85 Å, MicroED Structure of TLR2 TIR domain-induced MyD88 TIR domain higher-order assembly
7BEQ 3.0 Å, MicroED structure of the MyD88 TIR domain higher-order assembly
6I3N 3.1 Å, Helical MyD88 death domain filament
8W8M 3.28 Å, Cryo-EM structure of helical filament of MyD88 TIR
8YYM 3.3 Å, Cryo-EM structure of cylindrical fiber of MyD88 TIR
3MOP 3.4 Å, The ternary Death Domain complex of MyD88, IRAK4, and IRAK2

Browse structure collections

About this viewer

MolViewer shows 2JS7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.