2K1Z: Par-3 PDZ3

Solution structure of Par-3 PDZ3. Determined by solution NMR. Released 10 Jun 2008.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 1
Atoms: 778
Mol. weight: 11.14 kDa
Released: 10 Jun 2008

Explore 2K1Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K1Z contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	8-16	9	1
β-strand	28-34	7	1
β-strand	41-49	9	1
α-helix	54-58	5
α-helix	65	1
β-strand	66-70	5	1
β-strand	73-74	2	1
α-helix	80-93	14
β-strand	101-109	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Partitioning-defective 3 homolog	A	protein	104	Rattus norvegicus	Q9Z340 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2K1Z_1 Partitioning-defective 3 homolog (chains A)
GTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQ
LIAVNGESLLGKANQEAMETLRRSMSTEGNKRGMIQLIVARRIS

Primary citation

Solution structure of Par-3 PDZ3. Feng, W., Wu, H., Chan, L. et al. To be published.

Other PDB entries of the same protein (UniProt Q9Z340 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JUE 1.55 Å, The complex of PDZ and PBM
4DC2 2.4 Å, Structure of PKC in Complex with a Substrate Peptide from Par-3
9IMP 2.87 Å, The complex of PDZ3 and PBM
4I6P 2.9 Å, Crystal structure of Par3-NTD domain
3ZEE 6.1 Å, Electron cyro-microscopy helical reconstruction of Par-3 N terminal domain
2K20 Solution structure of Par-3 PDZ3 in complex with PTEN peptide
2NS5 The conserved N-terminal domain of Par-3 adopts a novel PB1-like structure required for…
2OGP Solution structure of the second PDZ domain of Par-3

Browse structure collections

About this viewer

MolViewer shows 2K1Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.