2KBI: Sodium channel protein type 5 subunit alpha

Solution NMR structure of the C-terminal EF-hand domain of human cardiac sodium channel NaV1.5. Determined by solution NMR. Released 23 Dec 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 772
Mol. weight: 10.99 kDa
Released: 23 Dec 2008

Explore 2KBI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KBI contains 6 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1788-1798	11
β-strand	1808-1810	3	1
α-helix	1811-1820	10
α-helix	1822	1
α-helix	1828	1
α-helix	1832-1837	6
β-strand	1847-1849	3	1
α-helix	1850-1862	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium channel protein type 5 subunit alpha	A	protein	97	Homo sapiens	Q14524 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KBI_1 Sodium channel protein type 5 subunit alpha (chains A)
GPGSENFSVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIA
KPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGES

Primary citation

Solution NMR Structure of the C-terminal EF-hand Domain of Human Cardiac Sodium Channel NaV1.5. Chagot, B., Potet, F., Balser, J.R. et al. J Biol Chem (2009) 284:6436-6445. DOI 10.1074/jbc.M807747200 · PubMed

Other PDB entries of the same protein (UniProt Q14524 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DJC 1.35 Å, 1.35 A crystal structure of the NaV1.5 DIII-IV-Ca/CaM complex
4DCK 2.2 Å, Crystal structure of the C-terminus of voltage-gated sodium channel in complex with…
5DBR 2.25 Å, Ca2+ CaM with human cardiac Na+ channel (NaV1.5) inactivation gate
6MUD 2.69 Å, Voltage-gated sodium channel NaV1.5 C-terminal domain in complex with Ca2+/Calmodulin
4OVN 2.8 Å, Voltage-gated Sodium Channel 1.5 (Nav1.5) C-terminal domain in complex with Calmodulin…
9V3S 3.0 Å, Nav1.5 in complex with quinidine-azo
6LQA 3.3 Å, voltage-gated sodium channel Nav1.5 with quinidine
7DTC 3.3 Å, voltage-gated sodium channel Nav1.5-E1784K
9ITH 3.4 Å, Nav1.5 in complex with TTX
9P24 3.48 Å, Structure of human cardiac sodium channel Nav1.5 in intermediate open state
8VYJ 3.6 Å, Structure of full-length human cardiac sodium channel - Class-I.
4JQ0 3.84 Å, Voltage-gated sodium channel 1.5 C-terminal domain in complex with FGF12B and…

Browse structure collections

About this viewer

MolViewer shows 2KBI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.