2KLR: Alpha-crystallin B chain

Solid-state NMR structure of the alpha-crystallin domain in alphaB-crystallin oligomers. Determined by solid-state NMR. Released 7 Jul 2010.

Method: Solid-state NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,332
Mol. weight: 40.38 kDa
Released: 7 Jul 2010

Explore 2KLR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KLR contains 2 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	74-79	6	1
α-helix	86-88	3
β-strand	89-94	6	2
β-strand	97-109	13	2
β-strand	112-123	12	2
β-strand	134-137	4	1
β-strand	143-148	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-crystallin B chain	A, B	protein	175	Homo sapiens	P02511 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2KLR_1 Alpha-crystallin B chain (chains A, B)
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSW
FDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHR
KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

Primary citation

Solid-state NMR and SAXS studies provide a structural basis for the activation of alphaB-crystallin oligomers. Jehle, S., Rajagopal, P., Bardiaux, B. et al. Nat Struct Mol Biol (2010) 17:1037-1042. DOI 10.1038/nsmb.1891 · PubMed

Other PDB entries of the same protein (UniProt P02511 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4M5S 1.37 Å, Human alphaB crystallin core domain in complex with C-terminal peptide
3SGP 1.4 Å, Amyloid-related segment of alphaB-crystallin residues 90-100 mutant V91L
7ROJ 1.6 Å, Amyloid-related segment of alphaB-crystallin residues 90-100 with G95W mutation
3SGM 1.7 Å, Bromoderivative-2 of amyloid-related segment of alphaB-crystallin residues 90-100
3SGS 1.7 Å, Amyloid-related segment of alphaB-crystallin residues 95-100
2Y1Y 2.0 Å, Human alphaB crystallin ACD(residues 71-157)
4M5T 2.0 Å, Disulfide trapped human alphaB crystallin core domain in complex with C-terminal peptide
3SGR 2.17 Å, Tandem repeat of amyloid-related segment of alphaB-crystallin residues 90-100 mutant V91L
2Y1Z 2.5 Å, Human alphaB Crystallin ACD R120G
3SGO 2.56 Å, Amyloid-related segment of alphaB-crystallin residues 90-100
2WJ7 2.63 Å, human alphaB crystallin
5VVV 2.8 Å, Structural Investigations of the Substrate Specificity of Human O-GlcNAcase

Browse structure collections

About this viewer

MolViewer shows 2KLR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.