2WJ7: Human alphaB crystallin

human alphaB crystallin. Determined by X-ray diffraction at 2.63 Å resolution. Released 11 Aug 2009.

Method: X-ray diffraction
Resolution: 2.63 Å
Organism: HOMO SAPIENS
Chains: 5
Atoms: 3,038
Mol. weight: 53.65 kDa
Released: 11 Aug 2009

Explore 2WJ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WJ7 contains 11 α-helices and 34 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	1
β-strand	11-17	7	1
α-helix	23-25	3
β-strand	26-31	6	2
β-strand	34-41	8	2
β-strand	45	1	2
β-strand	50-60	11	2
α-helix	61-62	2
α-helix	67-69	3
β-strand	71-74	4	1
β-strand	79-85	7	1

Chain B: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	14-17	4	3
α-helix	23-25	3
β-strand	26-31	6	2
β-strand	34-41	8	2
β-strand	45	1	2
β-strand	50-60	11	2
β-strand	72-75	4	3
β-strand	79-82	4	3

Chain C: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	3
β-strand	11-17	7	3
α-helix	23-25	3
β-strand	26-30	5	4
β-strand	34-45	12	4
β-strand	50-60	11	4
α-helix	61-62	2
α-helix	67-69	3
β-strand	71-75	5	3
β-strand	79-85	7	3

Chain D: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	15-17	3	5
α-helix	23-25	3
β-strand	26-31	6	4
β-strand	34-45	12	4
β-strand	50-60	11	4
β-strand	71-75	5	5
β-strand	79-83	5	5

Chain E: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	13-17	5	5
α-helix	23-25	3
β-strand	26-31	6	6
β-strand	34-45	12	6
β-strand	50-60	11	6
α-helix	61-62	2
α-helix	67-69	3
β-strand	71-75	5	5
β-strand	79-83	5	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-crystallin B chain	A, B, C, D, E	protein	94	HOMO SAPIENS	P02511 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>2WJ7_1 ALPHA-CRYSTALLIN B CHAIN (chains A, B, C, D, E)
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYR
IPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER

Primary citation

Crystal Structures of Alpha-Crystallin Domain Dimers of Alphab-Crystallin and Hsp20. Bagneris, C., Bateman, O.A., Naylor, C.E. et al. J Mol Biol (2009) 392:1242. DOI 10.1016/J.JMB.2009.07.069 · PubMed

Other PDB entries of the same protein (UniProt P02511 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4M5S 1.37 Å, Human alphaB crystallin core domain in complex with C-terminal peptide
3SGP 1.4 Å, Amyloid-related segment of alphaB-crystallin residues 90-100 mutant V91L
7ROJ 1.6 Å, Amyloid-related segment of alphaB-crystallin residues 90-100 with G95W mutation
3SGM 1.7 Å, Bromoderivative-2 of amyloid-related segment of alphaB-crystallin residues 90-100
3SGS 1.7 Å, Amyloid-related segment of alphaB-crystallin residues 95-100
2Y1Y 2.0 Å, Human alphaB crystallin ACD(residues 71-157)
4M5T 2.0 Å, Disulfide trapped human alphaB crystallin core domain in complex with C-terminal peptide
3SGR 2.17 Å, Tandem repeat of amyloid-related segment of alphaB-crystallin residues 90-100 mutant V91L
2Y1Z 2.5 Å, Human alphaB Crystallin ACD R120G
3SGO 2.56 Å, Amyloid-related segment of alphaB-crystallin residues 90-100
5VVV 2.8 Å, Structural Investigations of the Substrate Specificity of Human O-GlcNAcase
3SGN 2.81 Å, Bromoderivative-8 of amyloid-related segment of alphaB-crystallin residues 90-100

Browse structure collections

About this viewer

MolViewer shows 2WJ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.