2Y1Z: Human alphaB Crystallin ACD R120G

Human alphaB Crystallin ACD R120G. Determined by X-ray diffraction at 2.5 Å resolution. Released 2 Mar 2011.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,405
Mol. weight: 21.77 kDa
Ligands: MRD
Released: 2 Mar 2011

Explore 2Y1Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Y1Z contains 7 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	68-70	3	1
β-strand	74-80	7	1
α-helix	86-88	3
β-strand	89-94	6	2
β-strand	97-105	9	2
β-strand	112-123	12	2
α-helix	124-125	2
α-helix	130-132	3
β-strand	134-137	4	1
β-strand	142-148	7	1
α-helix	149-150	2

Chain B: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	66-70	5	3
β-strand	74-80	7	3
α-helix	86-88	3
β-strand	89-94	6	2
β-strand	97-108	12	2
β-strand	112-123	12	2
α-helix	124-125	2
α-helix	130-132	3
β-strand	134-137	4	3
β-strand	142-148	7	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-crystallin B chain	A, B	protein	94	HOMO SAPIENS	P02511 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2Y1Z_1 ALPHA-CRYSTALLIN B CHAIN (chains A, B)
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHGKYR
IPADVDPLTITSSMSSDGVLTVNGPRKQVSGPER

Ligands and cofactors

ID	Name	Formula	Copies
MRD	(4R)-2-methylpentane-2,4-diol	C6 H14 O2	3

Water and common crystallization additives (MPD) are not listed.

Primary citation

Crystal Structure of R120G Disease Mutant of Human Alphab-Crystallin Domain Dimer Shows Closure of a Groove. Clark, A.R., Naylor, C.E., Bagneris, C. et al. J Mol Biol (2011) 408:118. DOI 10.1016/J.JMB.2011.02.020 · PubMed

Other PDB entries of the same protein (UniProt P02511 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4M5S 1.37 Å, Human alphaB crystallin core domain in complex with C-terminal peptide
3SGP 1.4 Å, Amyloid-related segment of alphaB-crystallin residues 90-100 mutant V91L
7ROJ 1.6 Å, Amyloid-related segment of alphaB-crystallin residues 90-100 with G95W mutation
3SGM 1.7 Å, Bromoderivative-2 of amyloid-related segment of alphaB-crystallin residues 90-100
3SGS 1.7 Å, Amyloid-related segment of alphaB-crystallin residues 95-100
2Y1Y 2.0 Å, Human alphaB crystallin ACD(residues 71-157)
4M5T 2.0 Å, Disulfide trapped human alphaB crystallin core domain in complex with C-terminal peptide
3SGR 2.17 Å, Tandem repeat of amyloid-related segment of alphaB-crystallin residues 90-100 mutant V91L
3SGO 2.56 Å, Amyloid-related segment of alphaB-crystallin residues 90-100
2WJ7 2.63 Å, human alphaB crystallin
5VVV 2.8 Å, Structural Investigations of the Substrate Specificity of Human O-GlcNAcase
3SGN 2.81 Å, Bromoderivative-8 of amyloid-related segment of alphaB-crystallin residues 90-100

Browse structure collections

About this viewer

MolViewer shows 2Y1Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.