2KPW: Lamin-B1

NMR solution structure of Lamin-B1 protein from Homo sapiens: Northeast Structural Genomics Consortium MEGA target, HR5546A (439-549). Determined by solution NMR. Released 10 Nov 2009.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 960
Mol. weight: 13.67 kDa
Released: 10 Nov 2009

Explore 2KPW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KPW contains 0 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	15-20	6	1
β-strand	26-31	6	1
β-strand	37-38	2	2
β-strand	43-49	7	3
β-strand	51-56	6	3
β-strand	62-63	2	2
β-strand	67-72	6	1
β-strand	86-87	2	1
β-strand	101-105	5	3
β-strand	111-116	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lamin-B1	A	protein	122	Homo sapiens	P20700 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KPW_1 Lamin-B1 (chains A)
MGHHHHHHSHMTGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSR
YVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFK
TT

Primary citation

NMR solution structure of Lamin-B1 protein from Homo sapiens: Northeast Structural Genomics Consortium target, HR5546A (439-549). Swapna, G.V.T., Ciccosanti, C., Belote, R.L. et al. To be published.

Other PDB entries of the same protein (UniProt P20700 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UMN 2.0 Å, Crystal Structure of Lamin-B1
3JT0 2.39 Å, Crystal Structure of the C-terminal fragment (426-558) Lamin-B1 from Homo sapiens,…
3TYY 2.4 Å, Crystal Structure of Human Lamin-B1 Coil 2 Segment
5VVX 2.9 Å, Structural Investigations of the Substrate Specificity of Human O-GlcNAcase
7DTG 3.6 Å, Crystal structure of lamin B1 Ig-like domain from human

Browse structure collections

About this viewer

MolViewer shows 2KPW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.