Crystal Structure of Human Lamin-B1 Coil 2 Segment. Determined by X-ray diffraction at 2.4 Å resolution. Released 5 Oct 2011.
Explore 3TYY in 3D Show helices and sheets RCSB PDB PDBe
3TYY contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 315-381 | 67 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lamin-B1 | A, B | protein | 95 | Homo sapiens | P20700 (AlphaFold model) |
>3TYY_1 Lamin-B1 (chains A, B) MHHHHHHSSRENLYFQGQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQM QQQLNDYEQLLDVKLALDMEISAYRKLLEGEEERL
Crystal structures of the coil 2B fragment and the globular tail domain of human lamin B1. Ruan, J., Xu, C., Bian, C. et al. FEBS Lett (2012) 586:314-318. DOI 10.1016/j.febslet.2012.01.007 · PubMed
Other PDB entries of the same protein (UniProt P20700 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3TYY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.