3JT0: Lamin-B1

Crystal Structure of the C-terminal fragment (426-558) Lamin-B1 from Homo sapiens, Northeast Structural Genomics Consortium Target HR5546A. Determined by X-ray diffraction at 2.39 Å resolution. Released 22 Sept 2009.

Method: X-ray diffraction
Resolution: 2.39 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,686
Mol. weight: 32.29 kDa
Released: 22 Sept 2009

Explore 3JT0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JT0 contains 1 α-helix and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	28-33	6	1
β-strand	39-44	6	1
β-strand	50-51	2	2
β-strand	56-61	6	3
β-strand	64-69	6	3
β-strand	75-76	2	2
β-strand	81-86	6	1
α-helix	91-93	3
β-strand	94	1	1
β-strand	98-101	4	1
β-strand	114-118	5	3
β-strand	124-129	6	3

Chain B: 0 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	28-33	6	4
β-strand	39-44	6	4
β-strand	50-51	2	5
β-strand	56-61	6	6
β-strand	64-69	6	6
β-strand	75-76	2	5
β-strand	81-85	5	4
β-strand	94	1	4
β-strand	98-100	3	4
β-strand	113-118	6	6
β-strand	124-129	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lamin-B1	A, B	protein	144	Homo sapiens	P20700 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3JT0_1 Lamin-B1 (chains A, B)
MGHHHHHHSHMASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRK
IGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNS
QGEEVAQRSTVFKTTIPEEEEEEE

Primary citation

Northeast Structural Genomics Consortium Target HR5546A. Kuzin, A., Abashidze, M., Seetharaman, J. et al. To be published.

Other PDB entries of the same protein (UniProt P20700 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UMN 2.0 Å, Crystal Structure of Lamin-B1
3TYY 2.4 Å, Crystal Structure of Human Lamin-B1 Coil 2 Segment
5VVX 2.9 Å, Structural Investigations of the Substrate Specificity of Human O-GlcNAcase
7DTG 3.6 Å, Crystal structure of lamin B1 Ig-like domain from human
2KPW NMR solution structure of Lamin-B1 protein from Homo sapiens: Northeast Structural…

Browse structure collections

About this viewer

MolViewer shows 3JT0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.