3UMN: Lamin-B1

Crystal Structure of Lamin-B1. Determined by X-ray diffraction at 2.0 Å resolution. Released 30 Nov 2011.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,815
Mol. weight: 40.28 kDa
Released: 30 Nov 2011

Explore 3UMN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UMN contains 2 α-helices and 36 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	432-438	7	1
β-strand	442-447	6	2
β-strand	453-458	6	2
β-strand	464-465	2	3
β-strand	470-475	6	1
β-strand	478-483	6	1
β-strand	489-490	2	3
β-strand	495-500	6	2
β-strand	508	1	2
β-strand	512-515	4	2
β-strand	527-532	6	1
β-strand	538-546	9	1

Chain B: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	433-438	6	4
β-strand	442-447	6	5
β-strand	453-458	6	5
β-strand	464-465	2	6
β-strand	470-475	6	4
β-strand	478-483	6	4
β-strand	489-490	2	6
β-strand	495-500	6	5
α-helix	505-507	3
β-strand	508	1	5
β-strand	512-515	4	5
β-strand	527-532	6	4
β-strand	538-545	8	4

Chain C: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	432-438	7	4
β-strand	442-447	6	7
β-strand	453-458	6	7
β-strand	464-465	2	8
β-strand	470-475	6	4
β-strand	478-483	6	4
β-strand	489-490	2	8
α-helix	491	1
β-strand	495-499	5	7
β-strand	508	1	7
β-strand	512-514	3	7
β-strand	527-532	6	4
β-strand	538-546	9	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lamin-B1	A, B, C	protein	123	Homo sapiens	P20700 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3UMN_1 Lamin-B1 (chains A, B, C)
SSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSR
YVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFK
TTI

Primary citation

Crystal structures of the coil 2B fragment and the globular tail domain of human lamin B1. Ruan, J., Xu, C., Bian, C. et al. FEBS Lett (2012) 586:314-318. DOI 10.1016/j.febslet.2012.01.007 · PubMed

Other PDB entries of the same protein (UniProt P20700 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3JT0 2.39 Å, Crystal Structure of the C-terminal fragment (426-558) Lamin-B1 from Homo sapiens,…
3TYY 2.4 Å, Crystal Structure of Human Lamin-B1 Coil 2 Segment
5VVX 2.9 Å, Structural Investigations of the Substrate Specificity of Human O-GlcNAcase
7DTG 3.6 Å, Crystal structure of lamin B1 Ig-like domain from human
2KPW NMR solution structure of Lamin-B1 protein from Homo sapiens: Northeast Structural…

Browse structure collections

About this viewer

MolViewer shows 3UMN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.