7DTG: Lamin B1 Ig-like domain from human

Crystal structure of lamin B1 Ig-like domain from human. Determined by X-ray diffraction at 3.6 Å resolution. Released 3 Nov 2021.

Method: X-ray diffraction
Resolution: 3.6 Å
Organism: Homo sapiens
Chains: 6
Atoms: 5,448
Mol. weight: 98.08 kDa
Released: 3 Nov 2021

Explore 7DTG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7DTG contains 12 α-helices and 74 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	432-438	7	1
β-strand	442-447	6	2
β-strand	453-458	6	2
β-strand	464-465	2	3
β-strand	470-475	6	1
β-strand	478-483	6	1
α-helix	484-485	2
β-strand	489-490	2	3
β-strand	495-499	5	2
α-helix	501-503	3
β-strand	508	1	2
β-strand	512-514	3	2
β-strand	527-532	6	1
β-strand	538-546	9	1

Chain B: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	434-438	5	1
β-strand	442-447	6	4
β-strand	453-458	6	4
β-strand	464-465	2	5
β-strand	470-475	6	1
β-strand	478-483	6	1
α-helix	484-485	2
β-strand	489-490	2	5
β-strand	495-500	6	4
α-helix	501-503	3
α-helix	505-507	3
β-strand	508	1	4
β-strand	512-515	4	4
β-strand	527-532	6	1
β-strand	538-544	7	1

Chain C: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	432-438	7	6
β-strand	442-447	6	7
β-strand	453-458	6	7
α-helix	463	1
β-strand	464-465	2	8
β-strand	470-475	6	6
β-strand	478-483	6	6
α-helix	484-485	2
β-strand	489-490	2	8
β-strand	495-500	6	7
α-helix	501-503	3
α-helix	505-507	3
β-strand	512-515	4	7
β-strand	527-532	6	6
β-strand	538-546	9	6

Chain D: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	432-438	7	6
β-strand	442-447	6	9
β-strand	453-458	6	9
β-strand	464-465	2	10
β-strand	470-475	6	6
β-strand	478-483	6	6
α-helix	484-485	2
β-strand	489-490	2	10
β-strand	495-500	6	9
β-strand	508	1	9
β-strand	512-515	4	9
β-strand	528-532	5	6
β-strand	538-546	9	6

Chain E: 1 helix, 15 β-strands

Element	Residues	Length	Sheet
β-strand	432	1	13
β-strand	434-438	5	1
β-strand	442-447	6	14
β-strand	453-458	6	14
β-strand	464-465	2	15
β-strand	470-475	6	1
β-strand	478-483	6	1
α-helix	484-485	2
β-strand	489-490	2	15
β-strand	495-499	5	14
β-strand	508	1	14
β-strand	512-514	3	14
β-strand	527-532	6	1
β-strand	538	1	1
β-strand	540-543	4	1
β-strand	546	1	13

Chain F: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	432-438	7	1
β-strand	442-447	6	11
β-strand	453-458	6	11
β-strand	464-465	2	12
β-strand	470-475	6	1
β-strand	478-483	6	1
β-strand	489-490	2	12
β-strand	495-499	5	11
α-helix	501-503	3
β-strand	508	1	11
β-strand	512-514	3	11
β-strand	527-532	6	1
β-strand	538-546	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lamin-B1	A, B, C, D, E, F	protein	149	Homo sapiens	P20700 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>7DTG_1 Lamin-B1 (chains A, B, C, D, E, F)
GARSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQ
PMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTG
EDVKVILKNSQGEEVAQRSTVFKTTIPEE

Primary citation

Beta-strand-mediated dimeric formation of the Ig-like domains of human lamin A/C and B1. Ahn, J., Lee, J., Jeong, S. et al. Biochem Biophys Res Commun (2021) 550:191-196. DOI 10.1016/j.bbrc.2021.02.102 · PubMed

Other PDB entries of the same protein (UniProt P20700 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UMN 2.0 Å, Crystal Structure of Lamin-B1
3JT0 2.39 Å, Crystal Structure of the C-terminal fragment (426-558) Lamin-B1 from Homo sapiens,…
3TYY 2.4 Å, Crystal Structure of Human Lamin-B1 Coil 2 Segment
5VVX 2.9 Å, Structural Investigations of the Substrate Specificity of Human O-GlcNAcase
2KPW NMR solution structure of Lamin-B1 protein from Homo sapiens: Northeast Structural…

Browse structure collections

About this viewer

MolViewer shows 7DTG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.