Solution NMR Structure of the SH3 Domain from the p85beta subunit of Phosphatidylinositol 3-kinase from H.sapiens, Northeast Structural Genomics Consortium Target HR5531E. Determined by solution NMR. Released 26 Jan 2010.
Explore 2KT1 in 3D Show helices and sheets RCSB PDB PDBe
2KT1 contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-11 | 6 | 1 |
| β-strand | 15 | 1 | 2 |
| β-strand | 22 | 1 | 1 |
| β-strand | 25 | 1 | 2 |
| β-strand | 30-34 | 5 | 1 |
| α-helix | 35-41 | 7 | |
| α-helix | 51-54 | 4 | |
| β-strand | 56-61 | 6 | 1 |
| β-strand | 67-71 | 5 | 1 |
| β-strand | 75-81 | 7 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphatidylinositol 3-kinase regulatory subunit beta | A | protein | 88 | Homo sapiens | O00459 (AlphaFold model) |
>2KT1_1 Phosphatidylinositol 3-kinase regulatory subunit beta (chains A) MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGL NERTRQRGDFPGTYVEFLGPLEHHHHHH
Solution NMR Structure of the SH3 Domain from the p85beta subunit of Phosphatidylinositol 3-kinase from H.sapiens, Northeast Structural Genomics Consortium Target HR5531E. Aramini, J.M., Ma, L., Schauder, C. et al. To be published.
Other PDB entries of the same protein (UniProt O00459 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2KT1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.