Crystal structure of the SH3 domain from p85beta subunit of phosphoinositide 3-kinase (PI3K). Determined by X-ray diffraction at 2.01 Å resolution. Released 10 Aug 2011.
Explore 3O5Z in 3D Show helices and sheets RCSB PDB PDBe
3O5Z contains 11 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-11 | 6 | 1 |
| β-strand | 15 | 1 | 2 |
| β-strand | 22 | 1 | 1 |
| β-strand | 25 | 1 | 2 |
| β-strand | 30-34 | 5 | 1 |
| α-helix | 35-40 | 6 | |
| α-helix | 43-44 | 2 | |
| α-helix | 47-49 | 3 | |
| α-helix | 51-54 | 4 | |
| β-strand | 56-61 | 6 | 1 |
| β-strand | 67-71 | 5 | 1 |
| α-helix | 72-74 | 3 | |
| β-strand | 75-81 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-11 | 6 | 3 |
| β-strand | 15 | 1 | 4 |
| β-strand | 22 | 1 | 3 |
| α-helix | 23-24 | 2 | |
| β-strand | 25 | 1 | 4 |
| β-strand | 30-34 | 5 | 3 |
| α-helix | 35-40 | 6 | |
| α-helix | 43-44 | 2 | |
| α-helix | 47-49 | 3 | |
| α-helix | 51-54 | 4 | |
| β-strand | 56-61 | 6 | 3 |
| β-strand | 67-71 | 5 | 3 |
| α-helix | 72-74 | 3 | |
| β-strand | 75-80 | 6 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphatidylinositol 3-kinase regulatory subunit beta | A, B | protein | 90 | Homo sapiens | O00459 (AlphaFold model) |
>3O5Z_1 Phosphatidylinositol 3-kinase regulatory subunit beta (chains A, B) GPLGSMAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVG WMPGLNERTRQRGDFPGTYVEFLGPVALAR
X-ray structure of the SH3 domain of the phosphoinositide 3-kinase p85 beta subunit. Chen, S., Xiao, Y., Ponnusamy, R. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2011) 67:1328-1333. DOI 10.1107/S1744309111031691 · PubMed
Other PDB entries of the same protein (UniProt O00459 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3O5Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.