Crystal structure of iSH2 domain of human p85beta, Northeast Structural Genomics Consortium Target HR5531C. Determined by X-ray diffraction at 3.3 Å resolution. Released 19 May 2010.
Explore 3MTT in 3D Show helices and sheets RCSB PDB PDBe
3MTT contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 439-512 | 74 | |
| α-helix | 515-583 | 69 | |
| α-helix | 588-594 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphatidylinositol 3-kinase regulatory subunit beta | A | protein | 187 | Homo sapiens | O00459 (AlphaFold model) |
>3MTT_1 Phosphatidylinositol 3-kinase regulatory subunit beta (chains A) MIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIF EEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQQLRAQAS DNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQYALMEDL EHHHHHH
Structure of the iSH2 domain of human phosphatidylinositol 3-kinase p85beta subunit reveals conformational plasticity in the interhelical turn region. Schauder, C., Ma, L.C., Krug, R.M. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2010) 66:1567-1571. DOI 10.1107/S1744309110041333 · PubMed
Other PDB entries of the same protein (UniProt O00459 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3MTT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.