2XS6: Rhogap domain of human PIK3R2

Crystal structure of the rhogap domain of human PIK3R2. Determined by X-ray diffraction at 2.09 Å resolution. Released 17 Nov 2010.

Method: X-ray diffraction
Resolution: 2.09 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,361
Mol. weight: 22.99 kDa
Released: 17 Nov 2010

Explore 2XS6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XS6 contains 12 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	110-113	4
α-helix	114-117	4
α-helix	126-138	13
α-helix	144-146	3
α-helix	150-154	5
α-helix	162-164	3
α-helix	167-180	14
α-helix	188-199	12
α-helix	206-209	4
α-helix	216-235	20
α-helix	239-255	17
α-helix	279-293	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 3-kinase regulatory subunit beta	A	protein	214	HOMO SAPIENS	O00459 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2XS6_1 PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY SUBUNIT BETA (chains A)
MHHHHHHSSGVDLGTENLYFQSMGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGLDSES
HYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALREAAGP
VGPALEPPTLPLHRALTLRFLLQHLGRVARRAPALGPAVRALGATFGPLLLRAPPPPSSP
PPGGAPDGSEPSPDFPALLVEKLLQEHLEEQEVA

Primary citation

The Structure and Catalytic Mechanism of Human Sphingomyelin Phosphodiesterase Like 3A - an Acid Sphingomyelinase Homolog with a Novel Nucleotide Hydrolase Activity. Lim, S.M., Yeung, K., Tresaugues, L. et al. FEBS J (2016) 283:1107. DOI 10.1111/FEBS.13655 · PubMed

Other PDB entries of the same protein (UniProt O00459 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RNU 1.45 Å, nSH2 domain of p85-beta subunit of phosphatidylinositol 3-kinase in complex with an…
3O5Z 2.01 Å, Crystal structure of the SH3 domain from p85beta subunit of phosphoinositide 3-kinase…
6OX7 2.75 Å, The complex of 1918 NS1-ED and the iSH2 domain of the human p85beta subunit of PI3K
6U28 2.95 Å, Crystal structure of 1918 NS1-ED W187A in complex with the p85-beta-iSH2 domain of human…
7RCH 3.1 Å, Crystal structure of NS1-ED of Vietnam influenza A virus in complex with the…
3MTT 3.3 Å, Crystal structure of iSH2 domain of human p85beta, Northeast Structural Genomics…
2KT1 Solution NMR Structure of the SH3 Domain from the p85beta subunit of…

Browse structure collections

About this viewer

MolViewer shows 2XS6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.