7RNU: PDB entry 7RNU
nSH2 domain of p85-beta subunit of phosphatidylinositol 3-kinase in complex with an actin peptide with phosphorylated tyrosine 53. Determined by X-ray diffraction at 1.45 Å resolution. Released 11 Aug 2021.
- Method
- X-ray diffraction
- Resolution
- 1.45 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 4,196
- Mol. weight
- 56.87 kDa
- Released
- 11 Aug 2021
Explore 7RNU in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7RNU contains 20 α-helices and 38 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 334 | 1 | 1 |
| α-helix | 340-347 | 8 | |
| α-helix | 350-351 | 2 | |
| β-strand | 354-359 | 6 | 1 |
| β-strand | 368-374 | 7 | 1 |
| β-strand | 377-383 | 7 | 1 |
| β-strand | 384-386 | 3 | 2 |
| β-strand | 389-391 | 3 | 2 |
| α-helix | 396 | 1 | |
| β-strand | 398 | 1 | 2 |
| α-helix | 401-408 | 8 | |
| α-helix | 413-415 | 3 | |
| β-strand | 426-427 | 2 | 1 |
Chain B: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 53 | 1 | 1 |
Chain C: 4 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 325-327 | 3 | |
| β-strand | 334 | 1 | 3 |
| α-helix | 340-347 | 8 | |
| β-strand | 354-359 | 6 | 3 |
| β-strand | 368-374 | 7 | 3 |
| β-strand | 377-383 | 7 | 3 |
| β-strand | 384-386 | 3 | 4 |
| β-strand | 389-391 | 3 | 4 |
| β-strand | 398 | 1 | 4 |
| α-helix | 401-410 | 10 | |
| α-helix | 413-415 | 3 | |
| β-strand | 426-427 | 2 | 3 |
Chain D: 0 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 52-53 | 2 | 3 |
| β-strand | 57 | 1 | 5 |
Chain E: 5 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 334 | 1 | 6 |
| α-helix | 340-347 | 8 | |
| α-helix | 350-351 | 2 | |
| β-strand | 354-359 | 6 | 6 |
| β-strand | 368-374 | 7 | 6 |
| β-strand | 377-383 | 7 | 6 |
| β-strand | 384-386 | 3 | 7 |
| β-strand | 389-391 | 3 | 7 |
| β-strand | 394 | 1 | 5 |
| α-helix | 396 | 1 | |
| β-strand | 398 | 1 | 7 |
| α-helix | 401-410 | 10 | |
| α-helix | 413-415 | 3 | |
| β-strand | 426-427 | 2 | 6 |
Chains F and H: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 52-53 | 2 | 6 |
Chain G: 6 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 324-327 | 4 | |
| β-strand | 334-336 | 3 | 8 |
| α-helix | 340-347 | 8 | |
| α-helix | 350-351 | 2 | |
| β-strand | 354-359 | 6 | 8 |
| β-strand | 368-374 | 7 | 8 |
| β-strand | 377-383 | 7 | 8 |
| β-strand | 384-386 | 3 | 9 |
| β-strand | 389-391 | 3 | 9 |
| α-helix | 396 | 1 | |
| β-strand | 398 | 1 | 9 |
| α-helix | 401-410 | 10 | |
| α-helix | 413-415 | 3 | |
| β-strand | 426-427 | 2 | 8 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Phosphatidylinositol 3-kinase regulatory subunit beta | A, C, E, G | protein | 114 | Homo sapiens | O00459 (AlphaFold model) |
| Actin, alpha skeletal muscle | B, D, F, H | protein | 9 | Homo sapiens | P68133 (AlphaFold model) |
Sequence of entity 1 (A, C, E, G), FASTA
>7RNU_1 Phosphatidylinositol 3-kinase regulatory subunit beta (chains A, C, E, G)
GSMNGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGN
NKLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAKLDTRLLYPVSKY
Sequence of entity 2 (B, D, F, H), FASTA
>7RNU_2 Actin, alpha skeletal muscle (chains B, D, F, H)
KDSYVGDEA
Primary citation
The Functional Analysis of a Major Tyrosine Phosphorylation Site on Actin. Amelie, A., Dai, S., Shen, X. et al. To be published.
Other PDB entries of the same protein (UniProt O00459 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3O5Z 2.01 Å, Crystal structure of the SH3 domain from p85beta subunit of phosphoinositide 3-kinase…
- 2XS6 2.09 Å, Crystal structure of the rhogap domain of human PIK3R2
- 6OX7 2.75 Å, The complex of 1918 NS1-ED and the iSH2 domain of the human p85beta subunit of PI3K
- 6U28 2.95 Å, Crystal structure of 1918 NS1-ED W187A in complex with the p85-beta-iSH2 domain of human…
- 7RCH 3.1 Å, Crystal structure of NS1-ED of Vietnam influenza A virus in complex with the…
- 3MTT 3.3 Å, Crystal structure of iSH2 domain of human p85beta, Northeast Structural Genomics…
- 2KT1 Solution NMR Structure of the SH3 Domain from the p85beta subunit of…
Browse structure collections
About this viewer
MolViewer shows 7RNU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.