2KXH: Poly-binding-splicing factor PUF60

Solution structure of the first two RRM domains of FIR in the complex with FBP Nbox peptide. Determined by solution NMR. Released 18 Aug 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,759
Mol. weight: 25.08 kDa
Released: 18 Aug 2010

Explore 2KXH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KXH contains 10 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	106-111	6
β-strand	113-117	5	1
α-helix	125-131	7
β-strand	138-143	6	1
β-strand	156-160	5	1
α-helix	163-171	9
α-helix	182-183	2
β-strand	184-185	2	1
α-helix	195-205	11
α-helix	206-208	3
β-strand	210-214	5	2
α-helix	222-232	11
β-strand	235-240	6	2
α-helix	241-242	2
β-strand	252-257	6	2
α-helix	260-270	11
β-strand	274	1	3
β-strand	279	1	3
β-strand	281-284	4	2

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	30-44	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Poly(U)-binding-splicing factor PUF60	A	protein	199	Homo sapiens	Q9UHX1 (AlphaFold model)
peptide of Far upstream element-binding protein 1	B	protein	31	Homo sapiens	Q96AE4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KXH_1 Poly(U)-binding-splicing factor PUF60 (chains A)
GAMAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFV
EYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQ
DLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQ
YLRVGKAVTPPMPLLTPAT

Sequence of entity 2 (B), FASTA

>2KXH_2 peptide of Far upstream element-binding protein 1 (chains B)
GAMGYVNDAFKDALQRARQIAAKIGGDAGTS

Primary citation

Molecular basis of FIR-mediated c-myc transcriptional control. Cukier, C.D., Hollingworth, D., Martin, S.R. et al. Nat Struct Mol Biol (2010) 17:1058-1064. DOI 10.1038/nsmb.1883 · PubMed

Other PDB entries of the same protein (UniProt Q9UHX1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UE2 1.23 Å, Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa…
3US5 1.38 Å, Crystal structure of a RNA-binding domain of a poly-U binding splicing factor 60KDa…
7Z3X 1.65 Å, Crystal structure of FIR RRM1-2 Y115F mutant bound to FUSE ssDNA
5KW6 1.91 Å, Two Tandem RRM Domains of PUF60 Bound to an AdML Pre-mRNA 3' Splice Site Analogue with a…
5KVY 1.95 Å, Crystal structure of the two tandem rrm domains of PUF60 bound to a portion of an adml…
6LUR 2.0 Å, Human PUF60 UHM domain (thioredoxin fusion) in complex with a small molecule binder
7Q8A 2.05 Å, Crystal structure of tandem domain RRM1-2 of FUBP-interacting repressor (FIR) bound to…
2QFJ 2.1 Å, Crystal Structure of First Two RRM Domains of FIR Bound to ssDNA from a Portion of FUSE
5KW1 2.1 Å, Crystal Structure of the Two Tandem RRM Domains of PUF60 Bound to a Modified AdML…
3DXB 2.2 Å, Structure of the UHM domain of Puf60 fused to thioredoxin
3UWT 2.5 Å, Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa…
5KWQ 2.8 Å, Two Tandem RRM Domains of FBP-Interacting Repressor (FIR), also Known as PUF60

Browse structure collections

About this viewer

MolViewer shows 2KXH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.