2KXP: V-1

Solution NMR structure of V-1 bound to capping protein (CP). Determined by solution NMR. Released 9 Jun 2010.

Method: Solution NMR
Organisms: Gallus gallus, Mus musculus
Chains: 3
Atoms: 5,282
Mol. weight: 75.14 kDa
Released: 9 Jun 2010

Explore 2KXP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KXP contains 32 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	10-21	12
α-helix	24-25	2
α-helix	29-40	12
α-helix	43-48	6
α-helix	51-60	10
β-strand	63-64	2	1
β-strand	75-76	2	1
β-strand	81	1	2
β-strand	86-87	2	2
β-strand	94-95	2	3
β-strand	96-97	2	2
β-strand	109-110	2	3
α-helix	118-132	15
β-strand	139-148	10	4
β-strand	151-161	11	4
α-helix	165-167	3
β-strand	170-179	10	4
β-strand	190-198	9	4
β-strand	202	1	5
β-strand	204-212	9	4
α-helix	216-218	3
α-helix	221-249	29
α-helix	250-254	5
α-helix	255-258	4
α-helix	271-274	4

Chain B: 11 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	303-313	11
α-helix	318-320	3
α-helix	321-331	11
α-helix	333-335	3
α-helix	336-339	4
α-helix	347-348	2
β-strand	349-352	4	6
β-strand	357-360	4	6
β-strand	366-367	2	7
β-strand	370-371	2	7
β-strand	372	1	8
β-strand	379	1	8
α-helix	391-411	21
β-strand	416-423	8	4
β-strand	428-437	10	4
β-strand	444-456	13	4
β-strand	457	1	5
β-strand	465-473	9	5
β-strand	474-479	6	4
β-strand	486-490	5	4
β-strand	493-501	9	5
α-helix	509-530	22
α-helix	531-536	6
α-helix	537-543	7
α-helix	553-567	15

Chain C: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	603-607	5
α-helix	609-612	4
α-helix	615-622	8
α-helix	640-645	6
α-helix	653-656	4
α-helix	671-676	6
α-helix	682-688	7
α-helix	702-706	5
α-helix	711-714	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-actin-capping protein subunit alpha-1	A	protein	275	Gallus gallus	P13127 (AlphaFold model)
F-actin-capping protein subunit beta isoforms 1 and 2	B	protein	270	Gallus gallus	P14315 (AlphaFold model)
Myotrophin	C	protein	118	Mus musculus	P62774 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KXP_1 F-actin-capping protein subunit alpha-1 (chains A)
RVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVK
IEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQWRDACDS
ALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTA
QVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQTAISEN
YQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGK

Sequence of entity 2 (B), FASTA

>2KXP_2 F-actin-capping protein subunit beta isoforms 1 and 2 (chains B)
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLL
CDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYL
WDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNK
TGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVN
GLRSIDAIPDNQKYKQLQRELSQVLTQRQI

Sequence of entity 3 (C), FASTA

>2KXP_3 Myotrophin (chains C)
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGAD
INAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ

Primary citation

Solution NMR structure of V-1 bound to capping protein (CP). Zwolak, A., Fujiwara, I., Hammer III, J.A. et al. To be published.

Other PDB entries of the same protein (UniProt P13127 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DS6 1.69 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3AA0 1.7 Å, Crystal structure of Actin Capping Protein in complex with the Cp-binding motif derived…
7DS4 1.85 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail…
3AA1 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA6 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA7 1.9 Å, Crystal structure of Actin capping protein
7DS2 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail
7DS8 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3LK4 1.99 Å, Crystal structure of CapZ bound to the uncapping motif from CD2AP
9BLI 2.0 Å, Crystal structure of Actin capping protein in complex with a fragment of Legionella…
7DS3 2.09 Å, Crystal structure of actin capping protein in complex with twinflin-2 C-terminus tail
1IZN 2.1 Å, Crystal Structure of Actin Filament Capping Protein CapZ

Browse structure collections

About this viewer

MolViewer shows 2KXP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.