2KYG: PDB entry 2KYG

Structure of the AML1-ETO Nervy Domain - PKA(RIIa) complex and its contribution to AML1-ETO activity. Determined by solution NMR. Released 20 Oct 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 3
Atoms: 1,082
Mol. weight: 15.43 kDa
Released: 20 Oct 2010

Explore 2KYG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KYG contains 5 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-23	15
α-helix	28-41	14

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-23	15
α-helix	28-42	15

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	592-613	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase type II-alpha regulatory subunit	A, B	protein	50	Homo sapiens	P13861 (AlphaFold model)
Protein CBFA2T1	C	protein	38	Homo sapiens	Q06455 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2KYG_1 cAMP-dependent protein kinase type II-alpha regulatory subunit (chains A, B)
GAMGSMSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA

Sequence of entity 2 (C), FASTA

>2KYG_2 Protein CBFA2T1 (chains C)
AMADIGSASGYVPEEIWKKAEEAVNEVKRQAMTELQKA

Primary citation

Structure of the AML1-ETO NHR3-PKA(RIIalpha) complex and its contribution to AML1-ETO activity. Corpora, T., Roudaia, L., Oo, Z.M. et al. J Mol Biol (2010) 402:560-577. DOI 10.1016/j.jmb.2010.08.007 · PubMed

Other PDB entries of the same protein (UniProt P13861 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IZX 1.3 Å, Molecular Basis of AKAP Specificity for PKA Regulatory Subunits
5H78 2.0 Å, Crystal structure of the PKA-DHR14 fusion protein
9NXN 2.1 Å, Crystal structure of CN:RII alpha
4ZP3 2.63 Å, AKAP18:PKA-RIIalpha structure reveals crucial anchor points for recognition of…
5H77 3.2 Å, Crystal structure of the PKA-protein A fusion protein
5XBY 3.25 Å, Crystal structure of the PKA-Protein A fusion protein (end-to-end fusion)
8S8O Solution Structure of cAMP-dependent Protein Kinase RII-alpha Subunit Dimerization and…

Browse structure collections

About this viewer

MolViewer shows 2KYG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.