2KZ7: CARMIL CAH3a/b domain

Solution structure of the CARMIL CAH3a/b domain bound to capping protein (CP). Determined by solution NMR. Released 14 Jul 2010.

Method: Solution NMR
Organisms: Gallus gallus, Mus musculus
Chains: 3
Atoms: 5,020
Mol. weight: 73.85 kDa
Released: 14 Jul 2010

Explore 2KZ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KZ7 contains 24 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	10-22	13
α-helix	24-25	2
α-helix	29-40	12
α-helix	43-60	18
β-strand	63-65	3	1
β-strand	74-76	3	1
β-strand	81	1	2
β-strand	86-88	3	2
β-strand	94-97	4	2
α-helix	98-99	2
β-strand	109-110	2	2
α-helix	118-135	18
β-strand	139-148	10	3
β-strand	151-164	14	3
α-helix	165-167	3
β-strand	169-180	12	3
β-strand	185-198	14	3
β-strand	202-217	16	3
α-helix	222-249	28
α-helix	250-254	5
α-helix	255-258	4
α-helix	271-274	4

Chain B: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	303-313	11
α-helix	318-320	3
α-helix	321-331	11
α-helix	333-335	3
α-helix	336-342	7
α-helix	347	1
β-strand	348-352	5	4
β-strand	357-361	5	4
α-helix	363-365	3
β-strand	366-367	2	5
β-strand	370-372	3	5
β-strand	379-380	2	5
α-helix	391-412	22
β-strand	416-423	8	3
β-strand	427-437	11	3
β-strand	444-458	15	3
β-strand	464-481	18	3
α-helix	482-484	3
β-strand	485-502	18	3
α-helix	509-530	22
α-helix	531-535	5
α-helix	536-543	8
α-helix	553-567	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-actin-capping protein subunit alpha-1	A	protein	286	Gallus gallus	P13127 (AlphaFold model)
F-actin-capping protein subunit beta isoforms 1 and 2	B	protein	277	Gallus gallus	P14315 (AlphaFold model)
Leucine-rich repeat-containing protein 16A	C	protein	85	Mus musculus	Q6EDY6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KZ7_1 F-actin-capping protein subunit alpha-1 (chains A)
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQW
RDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Sequence of entity 2 (B), FASTA

>2KZ7_2 F-actin-capping protein subunit beta isoforms 1 and 2 (chains B)
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSIDAIPDNQKYKQLQRELSQVLTQRQIYIQPDN

Sequence of entity 3 (C), FASTA

>2KZ7_3 Leucine-rich repeat-containing protein 16A (chains C)
GAMGSWGCVRQEKRSSGLISELPSEEGRRLEHFTKLRPKRNKKQQPTQAAVCTISILPQD
GEQNGLMGRVDEGVDEFFTKKVTGC

Primary citation

Solution structure of the CARMIL CAH3a/b domain bound to capping protein (CP). Zwolak, A., Uruno, T., Piszczek, G.P. et al. To be published.

Other PDB entries of the same protein (UniProt P13127 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DS6 1.69 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3AA0 1.7 Å, Crystal structure of Actin Capping Protein in complex with the Cp-binding motif derived…
7DS4 1.85 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail…
3AA1 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA6 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA7 1.9 Å, Crystal structure of Actin capping protein
7DS2 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail
7DS8 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3LK4 1.99 Å, Crystal structure of CapZ bound to the uncapping motif from CD2AP
9BLI 2.0 Å, Crystal structure of Actin capping protein in complex with a fragment of Legionella…
7DS3 2.09 Å, Crystal structure of actin capping protein in complex with twinflin-2 C-terminus tail
1IZN 2.1 Å, Crystal Structure of Actin Filament Capping Protein CapZ

Browse structure collections

About this viewer

MolViewer shows 2KZ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.