2LAH: PDB entry 2LAH

Solution NMR Structure of Mitotic checkpoint serine/threonine-protein kinase BUB1 N-terminal domain from Homo sapiens, Northeast Structural Genomics Consortium Target HR5460A (Methods Development). Determined by solution NMR. Released 11 May 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,358
Mol. weight: 19.21 kDa
Released: 11 May 2011

Explore 2LAH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LAH contains 10 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	14-26	13
α-helix	34-47	14
α-helix	52-65	14
α-helix	70-72	3
α-helix	76-86	11
α-helix	92-101	10
β-strand	108	1	1
α-helix	109-122	14
α-helix	125-138	14
α-helix	140	1
β-strand	141	1	1
α-helix	143-157	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitotic checkpoint serine/threonine-protein kinase BUB1	A	protein	160	Homo sapiens	O43683 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LAH_1 Mitotic checkpoint serine/threonine-protein kinase BUB1 (chains A)
MGHHHHHHSHMDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLE
HLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLE
AQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRLTET

Primary citation

Northeast Structural Genomics Consortium Target HR5460A. Liu, G., Shastry, R., Ciccosanti, C. et al. To be published.

Other PDB entries of the same protein (UniProt O43683 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7B1F 1.75 Å, Orthorhombic P212121 Structure of Human Mad1 C-terminal Domain in Complex with…
9RJ4 1.85 Å, Bub1 kinase domain in complex with inhibitor LEI221
6F7B 2.0 Å, Crystal structure of the human Bub1 kinase domain in complex with BAY 1816032
4QPM 2.2 Å, Structure of Bub1 kinase domain
9RJ2 2.3 Å, Bub1 kinase domain in complex with covalent inhibitor BM047
4R8Q 2.31 Å, Structure and substrate recruitment of the human spindle checkpoint kinase bub1
5DMZ 2.4 Å, Structure of human Bub1 kinase domain phosphorylated at Ser969
7B1H 2.4 Å, Monoclinic P21 Structure of Human Mad1 C-terminal Domain in Complex with Phosphorylated…
4A1G 2.6 Å, The crystal structure of the human Bub1 TPR domain in complex with the KI motif of Knl1
7B1J 2.9 Å, Orthorhombic P21212 Structure of Human Mad1 C-terminal Domain in Complex with…

Browse structure collections

About this viewer

MolViewer shows 2LAH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.