2LE8: The protein complex for DNA replication

Name: PDB 2LE8: The protein complex for DNA replication
Published: 2012-12-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: replication

The protein complex for DNA replication. Determined by solution NMR. Released 19 Dec 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,173
Mol. weight: 16.67 kDa
Released: 19 Dec 2012

Explore 2LE8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LE8 contains 6 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
α-helix	15-34	20
α-helix	42-53	12
α-helix	60-77	18
β-strand	84-85	2	1
β-strand	109-110	2	1

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	387-390	4
α-helix	392-402	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA replication licensing factor MCM6	A	protein	114	Homo sapiens	Q14566 (AlphaFold model)
DNA replication factor Cdt1	B	protein	29	Homo sapiens	Q9H211 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LE8_1 DNA replication licensing factor MCM6 (chains A)
APKASLRLGFSEYSRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELI
NKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED

Sequence of entity 2 (B), FASTA

>2LE8_2 DNA replication factor Cdt1 (chains B)
SALKGVSQDLLERIRAKEAQKQLAQMTRW

Primary citation

Structural insights into the Cdt1-mediated MCM2-7 chromatin loading. Liu, C., Wu, R., Zhou, B. et al. Nucleic Acids Res (2012) 40:3208-3217. DOI 10.1093/nar/gkr1118 · PubMed

Other PDB entries of the same protein (UniProt Q14566 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7W1Y 2.59 Å, Human MCM double hexamer bound to natural DNA duplex (polyAT/polyTA)
9E2Z 2.6 Å, Cryo-EM structure of human CMG helicase stalled at G4-containing DNA template
7PLO 2.8 Å, H. sapiens replisome-CUL2/LRR1 complex
8W0F 2.8 Å, Cryo-EM structure of a human MCM2-7 double hexamer on dsDNA
8S09 3.1 Å, H. sapiens MCM2-7 double hexamer bound to double stranded DNA
7PFO 3.2 Å, Core human replisome
8S0A 3.2 Å, H. sapiens MCM2-7 hexamer bound to double stranded DNA
9CAQ 3.2 Å, Cryo-EM structure of a human MCM2-7 double hexamer formed from independently loaded…
9LXD 3.27 Å, Structure of DNA-free MCM SH at 3.2 Angstroms resolution
6XTX 3.29 Å, CryoEM structure of human CMG bound to ATPgammaS and DNA
22VT 3.3 Å, Structure of human MCM2-7 single hexamer with MCM3-WHD attached to MCM2-CTD, containing…
8B9D 3.4 Å, Human replisome bound by Pol Alpha

Browse structure collections

About this viewer

MolViewer shows 2LE8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.