2LFG: Human prolactin receptor ecd domain d2

Solution structure of the human prolactin receptor ecd domain d2. Determined by solution NMR. Released 15 Feb 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 946
Mol. weight: 13.34 kDa
Released: 15 Feb 2012

Explore 2LFG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LFG contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	107-114	8	1
α-helix	120-121	2
β-strand	122-128	7	1
α-helix	129-130	2
β-strand	144-150	7	2
β-strand	157-162	6	2
β-strand	166-169	4	1
β-strand	176-184	9	2
β-strand	198-202	5	2
α-helix	203	1
α-helix	204-206	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prolactin receptor	A	protein	113	Homo sapiens	P16471 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LFG_1 Prolactin receptor (chains A)
MYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWE
IHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMND

Primary citation

The WSXWS Motif in Cytokine Receptors Is a Molecular Switch Involved in Receptor Activation: Insight from Structures of the Prolactin Receptor. Dagil, R., Knudsen, M.J., Olsen, J.G. et al. Structure (2012) 20:270-282. DOI 10.1016/j.str.2011.12.010 · PubMed

Other PDB entries of the same protein (UniProt P16471 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3N06 2.0 Å, A mutant human Prolactin receptor antagonist H27A in complex with the extracellular…
3NCE 2.0 Å, A mutant human Prolactin receptor antagonist H27A in complex with the mutant…
3MZG 2.1 Å, Crystal structure of a human prolactin receptor antagonist in complex with the…
3N0P 2.1 Å, A mutant human Prolactin receptor antagonist H30A in complex with the extracellular…
3NCB 2.1 Å, A mutant human Prolactin receptor antagonist H180A in complex with the extracellular…
3D48 2.5 Å, Crystal structure of a prolactin receptor antagonist bound to the extracellular domain…
3NCC 2.5 Å, A human Prolactin receptor antagonist in complex with the mutant extracellular domain…
3NCF 2.8 Å, A mutant human Prolactin receptor antagonist H30A in complex with the mutant…
1BP3 2.9 Å, The xray structure of a growth hormone-prolactin receptor complex
4I18 3.24 Å, Crystal structure of human prolactin receptor complexed with Fab fragment
2N7I NMR structure of the prolactin receptor transmembrane domain

Browse structure collections

About this viewer

MolViewer shows 2LFG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.