Solution structure of the human prolactin receptor ecd domain d2. Determined by solution NMR. Released 15 Feb 2012.
Explore 2LFG in 3D Show helices and sheets RCSB PDB PDBe
2LFG contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 107-114 | 8 | 1 |
| α-helix | 120-121 | 2 | |
| β-strand | 122-128 | 7 | 1 |
| α-helix | 129-130 | 2 | |
| β-strand | 144-150 | 7 | 2 |
| β-strand | 157-162 | 6 | 2 |
| β-strand | 166-169 | 4 | 1 |
| β-strand | 176-184 | 9 | 2 |
| β-strand | 198-202 | 5 | 2 |
| α-helix | 203 | 1 | |
| α-helix | 204-206 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Prolactin receptor | A | protein | 113 | Homo sapiens | P16471 (AlphaFold model) |
>2LFG_1 Prolactin receptor (chains A) MYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWE IHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMND
The WSXWS Motif in Cytokine Receptors Is a Molecular Switch Involved in Receptor Activation: Insight from Structures of the Prolactin Receptor. Dagil, R., Knudsen, M.J., Olsen, J.G. et al. Structure (2012) 20:270-282. DOI 10.1016/j.str.2011.12.010 · PubMed
Other PDB entries of the same protein (UniProt P16471 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2LFG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.