3MZG: Human prolactin receptor antagonist

Crystal structure of a human prolactin receptor antagonist in complex with the extracellular domain of the human prolactin receptor. Determined by X-ray diffraction at 2.1 Å resolution. Released 29 Sept 2010.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,505
Mol. weight: 46.34 kDa
Released: 29 Sept 2010

Explore 3MZG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MZG contains 18 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	15-44	30
α-helix	50-53	4
α-helix	69-74	6
α-helix	77-103	27
α-helix	110-137	28
α-helix	148-150	3
α-helix	153-157	5
α-helix	161-195	35

Chain B: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4	1	1
β-strand	8-13	6	2
β-strand	14	1	3
β-strand	20-25	6	2
α-helix	26-27	2
β-strand	31	1	1
β-strand	35-42	8	4
β-strand	49-50	2	4
β-strand	61-64	4	2
α-helix	66-68	3
β-strand	75-83	9	4
β-strand	86-89	4	4
α-helix	90-92	3
β-strand	93-95	3	4
α-helix	97-99	3
β-strand	101	1	3
α-helix	103-106	4
β-strand	107-114	8	5
β-strand	122-128	7	5
α-helix	129-130	2
β-strand	142-149	8	6
β-strand	157-162	6	6
β-strand	166-169	4	5
α-helix	172-173	2
β-strand	177-186	10	6
α-helix	191-197	7
β-strand	198-201	4	6
α-helix	202-203	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prolactin	A	protein	186	Homo sapiens	P01236 (AlphaFold model)
Prolactin receptor	B	protein	210	Homo sapiens	P16471 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3MZG_1 Prolactin (chains A)
MLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQ
QMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLERMELI
VSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRI
IHNNNC

Sequence of entity 2 (B), FASTA

>3MZG_2 Prolactin receptor (chains B)
MLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPN
SCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRK
PYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLV
QVRCKPDHGYWSAWSPATFIQIPSDFTMND

Primary citation

Two Independent Histidines, One in Human Prolactin and One in Its Receptor, Are Critical for pH-dependent Receptor Recognition and Activation. Kulkarni, M.V., Tettamanzi, M.C., Murphy, J.W. et al. J Biol Chem (2010) 285:38524-38533. DOI 10.1074/jbc.M110.172072 · PubMed

Other PDB entries of the same protein (UniProt P01236 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3N06 2.0 Å, A mutant human Prolactin receptor antagonist H27A in complex with the extracellular…
3NCE 2.0 Å, A mutant human Prolactin receptor antagonist H27A in complex with the mutant…
3N0P 2.1 Å, A mutant human Prolactin receptor antagonist H30A in complex with the extracellular…
3NCB 2.1 Å, A mutant human Prolactin receptor antagonist H180A in complex with the extracellular…
3D48 2.5 Å, Crystal structure of a prolactin receptor antagonist bound to the extracellular domain…
3NCC 2.5 Å, A human Prolactin receptor antagonist in complex with the mutant extracellular domain…
2Q98 2.7 Å, X-ray structure of a prolactin antagonist
3NCF 2.8 Å, A mutant human Prolactin receptor antagonist H30A in complex with the mutant…
3NPZ 3.35 Å, Prolactin Receptor (PRLR) Complexed with the Natural Hormone (PRL)
3EW3 3.8 Å, the 1:2 complex between a Nterminal elongated prolactin and the extra cellular domain of…
1RW5 Solution structure of human prolactin

Browse structure collections

About this viewer

MolViewer shows 3MZG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.