A mutant human Prolactin receptor antagonist H27A in complex with the mutant extracellular domain H188A of the human prolactin receptor. Determined by X-ray diffraction at 2.0 Å resolution. Released 29 Sept 2010.
Explore 3NCE in 3D Show helices and sheets RCSB PDB PDBe
3NCE contains 18 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 15-40 | 26 | |
| α-helix | 41-45 | 5 | |
| α-helix | 50-53 | 4 | |
| α-helix | 69-74 | 6 | |
| α-helix | 77-103 | 27 | |
| α-helix | 110-137 | 28 | |
| α-helix | 147-150 | 4 | |
| α-helix | 153-157 | 5 | |
| α-helix | 161-195 | 35 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3 | 1 | |
| β-strand | 4 | 1 | 1 |
| α-helix | 5 | 1 | |
| β-strand | 8-13 | 6 | 2 |
| β-strand | 14 | 1 | 3 |
| β-strand | 20-25 | 6 | 2 |
| β-strand | 31 | 1 | 1 |
| α-helix | 32-33 | 2 | |
| β-strand | 35-42 | 8 | 4 |
| β-strand | 49-50 | 2 | 4 |
| β-strand | 61-64 | 4 | 2 |
| α-helix | 66-68 | 3 | |
| β-strand | 75-83 | 9 | 4 |
| β-strand | 86-89 | 4 | 4 |
| α-helix | 90-92 | 3 | |
| β-strand | 93-95 | 3 | 4 |
| α-helix | 97-100 | 4 | |
| β-strand | 101 | 1 | 3 |
| α-helix | 103-106 | 4 | |
| β-strand | 107-114 | 8 | 5 |
| β-strand | 122-128 | 7 | 5 |
| β-strand | 142-149 | 8 | 6 |
| β-strand | 157-162 | 6 | 6 |
| β-strand | 166-169 | 4 | 5 |
| β-strand | 177-186 | 10 | 6 |
| α-helix | 191-197 | 7 | |
| β-strand | 198-201 | 4 | 6 |
| α-helix | 202-203 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Prolactin | A | protein | 186 | Homo sapiens | P01236 (AlphaFold model) |
| Prolactin receptor | B | protein | 210 | Homo sapiens | P16471 (AlphaFold model) |
>3NCE_1 Prolactin (chains A) MLRDLFDRAVVLSAYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQ QMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLERMELI VSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRI IHNNNC
>3NCE_2 Prolactin receptor (chains B) MLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPN SCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRK PYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLV QVRCKPDAGYWSAWSPATFIQIPSDFTMND
| ID | Name | Formula | Copies |
|---|---|---|---|
| CO3 | Carbonate ion | C O3 | 2 |
Water and common crystallization additives (NA, CL) are not listed.
Two Independent Histidines, One in Human Prolactin and One in Its Receptor, Are Critical for pH-dependent Receptor Recognition and Activation. Kulkarni, M.V., Tettamanzi, M.C., Murphy, J.W. et al. J Biol Chem (2010) 285:38524-38533. DOI 10.1074/jbc.M110.172072 · PubMed
Other PDB entries of the same protein (UniProt P01236 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3NCE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.