3D48: Prolactin receptor antagonist

Crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor. Determined by X-ray diffraction at 2.5 Å resolution. Released 3 Jun 2008.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,064
Mol. weight: 46.72 kDa
Ligands: CO3
Released: 3 Jun 2008

Explore 3D48 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3D48 contains 14 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain P: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	15-40	26
α-helix	51-54	4
α-helix	59-62	4
α-helix	69-72	4
α-helix	77-102	26
α-helix	112-136	25
α-helix	153-156	4
α-helix	161-193	33

Chain R: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	6-13	8	1
β-strand	14	1	2
β-strand	20-28	9	1
β-strand	35-42	8	3
β-strand	49-50	2	3
β-strand	61-64	4	1
α-helix	66-68	3
β-strand	74-83	10	3
β-strand	86-89	4	3
α-helix	90-92	3
β-strand	93-96	4	3
α-helix	97-99	3
β-strand	101	1	2
α-helix	103-106	4
β-strand	107-112	6	4
β-strand	123-128	6	4
α-helix	129-130	2
β-strand	142-150	9	5
β-strand	157-162	6	5
β-strand	166-169	4	4
β-strand	177-186	10	5
α-helix	191-194	4
β-strand	198-201	4	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prolactin	P	protein	188	Homo sapiens	P01236 (AlphaFold model)
Prolactin receptor	R	protein	211	Homo sapiens	P16471 (AlphaFold model)

Sequence of entity 1 (P), FASTA

>3D48_1 Prolactin (chains P)
SVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQ
AQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLERME
LIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKC
RIIHNNNC

Sequence of entity 2 (R), FASTA

>3D48_2 Prolactin receptor (chains R)
SQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGP
NSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDR
KPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYL
VQVRCKPDHGYWSAWSPATFIQIPSDFTMND

Ligands and cofactors

ID	Name	Formula	Copies
CO3	Carbonate ion	C O3	4

Primary citation

Crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor. Svensson, L.A., Bondensgaard, K., Norskov-Lauritsen, L. et al. J Biol Chem (2008) 283:19085-19094. DOI 10.1074/jbc.M801202200 · PubMed

Other PDB entries of the same protein (UniProt P01236 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3N06 2.0 Å, A mutant human Prolactin receptor antagonist H27A in complex with the extracellular…
3NCE 2.0 Å, A mutant human Prolactin receptor antagonist H27A in complex with the mutant…
3MZG 2.1 Å, Crystal structure of a human prolactin receptor antagonist in complex with the…
3N0P 2.1 Å, A mutant human Prolactin receptor antagonist H30A in complex with the extracellular…
3NCB 2.1 Å, A mutant human Prolactin receptor antagonist H180A in complex with the extracellular…
3NCC 2.5 Å, A human Prolactin receptor antagonist in complex with the mutant extracellular domain…
2Q98 2.7 Å, X-ray structure of a prolactin antagonist
3NCF 2.8 Å, A mutant human Prolactin receptor antagonist H30A in complex with the mutant…
3NPZ 3.35 Å, Prolactin Receptor (PRLR) Complexed with the Natural Hormone (PRL)
3EW3 3.8 Å, the 1:2 complex between a Nterminal elongated prolactin and the extra cellular domain of…
1RW5 Solution structure of human prolactin

Browse structure collections

About this viewer

MolViewer shows 3D48 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.