RNA-binding zinc finger protein. Determined by solution NMR. Released 27 Jun 2012.
Explore 2LHN in 3D Show helices and sheets RCSB PDB PDBe
2LHN contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 414 | 1 | 1 |
| α-helix | 418-420 | 3 | |
| β-strand | 429 | 1 | 1 |
| α-helix | 435 | 1 | |
| β-strand | 436 | 1 | 2 |
| α-helix | 437 | 1 | |
| α-helix | 440-442 | 3 | |
| β-strand | 451 | 1 | 2 |
| β-strand | 457 | 1 | 3 |
| β-strand | 472 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nuclear polyadenylated RNA-binding protein NAB2 | A | protein | 80 | Saccharomyces cerevisiae S288c | P32505 (AlphaFold model) |
>2LHN_1 Nuclear polyadenylated RNA-binding protein NAB2 (chains A) GPLGSEKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINEDCRFGVN CKNIYCLFRHPPGRVLPEKK
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
Structural Basis for Polyadenosine-RNA Binding by Nab2 Zn Fingers and Its Function in mRNA Nuclear Export. Brockmann, C., Soucek, S., Kuhlmann, S.I. et al. Structure (2012) 20:1007-1018. DOI 10.1016/j.str.2012.03.011 · PubMed
Other PDB entries of the same protein (UniProt P32505 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2LHN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.