3LCN: Nab2:Gfd1 complex

Nab2:Gfd1 complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 12 May 2010.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 1,977
Mol. weight: 30.21 kDa
Ligands: ZN
Released: 12 May 2010

Explore 3LCN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LCN contains 12 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	7-18	12
α-helix	28-40	13
α-helix	45-55	11
α-helix	61-79	19
α-helix	84-96	13

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	5-18	14
α-helix	28-40	13
α-helix	45-55	11
α-helix	61-79	19
α-helix	84-96	13

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	127-149	23

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	131-147	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear polyadenylated RNA-binding protein NAB2	A, B	protein	105	Saccharomyces cerevisiae	P32505 (AlphaFold model)
mRNA transport factor GFD1	C, D	protein	29	Saccharomyces cerevisiae	Q04839 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3LCN_1 Nuclear polyadenylated RNA-binding protein NAB2 (chains A, B)
MSQEQYTENLKVIVAEKLAGIPNFNEDIKYVAEYIVLLIVNGGTVESVVDELASLFDSVS
RDTLANVVQTAFFALEALQQGESAENIVSKIRMMNAQSLGQSDIA

Sequence of entity 2 (C, D), FASTA

>3LCN_2 mRNA transport factor GFD1 (chains C, D)
KQDTASKMKLLKKKIEEQREILQKTHHKN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Structural basis for the function of the Saccharomyces cerevisiae Gfd1 protein in mRNA nuclear export. Zheng, C., Fasken, M.B., Marshall, N.J. et al. J Biol Chem (2010) 285:20704-20715. DOI 10.1074/jbc.M110.107276 · PubMed

Other PDB entries of the same protein (UniProt P32505 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5L2L 1.55 Å, Nab2 Zn fingers 5-7 bound to A11G RNA
2V75 1.8 Å, N-terminal domain of Nab2
4JLQ 3.05 Å, Crystal structure of human Karyopherin-beta2 bound to the PY-NLS of Saccharomyces…
2JPS NAB2 N-terminal domain
2LHN RNA-binding zinc finger protein
3ZJ1 Structure of Nab2p tandem zinc finger 12
3ZJ2 Structure of Nab2p tandem zinc finger 34

Browse structure collections

About this viewer

MolViewer shows 3LCN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.