Structure of Nab2p tandem zinc finger 34. Determined by solution NMR. Released 11 Sept 2013.
Explore 3ZJ2 in 3D Show helices and sheets RCSB PDB PDBe
3ZJ2 contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 339 | 1 | 1 |
| α-helix | 343-345 | 3 | |
| β-strand | 354 | 1 | 1 |
| β-strand | 355 | 1 | 2 |
| β-strand | 370 | 1 | 3 |
| α-helix | 374-376 | 3 | |
| β-strand | 385 | 1 | 3 |
| β-strand | 386 | 1 | 2 |
| α-helix | 390-393 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nuclear polyadenylated RNA-binding protein NAB2 | A | protein | 71 | SACCHAROMYCES CEREVISIAE | P32505 (AlphaFold model) |
>3ZJ2_1 NUCLEAR POLYADENYLATED RNA-BINDING PROTEIN NAB2 (chains A) GSVQTGIVLCKFGALCSNPSCPFGHPTPANEDAKVIDLMWCDKNLTCDNPECRKAHSSLS KIKEVKPISQK
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Two Singular Types of Ccch Tandem Zinc Finger in Nab2P Contribute to Polyadenosine RNA Recognition. Martinez-Lumbreras, S., Santiveri, C.M., Mirassou, Y. et al. Structure (2013) 21:1800. DOI 10.1016/J.STR.2013.07.019 · PubMed
Other PDB entries of the same protein (UniProt P32505 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3ZJ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.