3ZJ2: Nab2p tandem zinc finger 34

Structure of Nab2p tandem zinc finger 34. Determined by solution NMR. Released 11 Sept 2013.

Method: Solution NMR
Organism: SACCHAROMYCES CEREVISIAE
Chains: 1
Atoms: 536
Mol. weight: 7.83 kDa
Ligands: ZN
Released: 11 Sept 2013

Explore 3ZJ2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ZJ2 contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	339	1	1
α-helix	343-345	3
β-strand	354	1	1
β-strand	355	1	2
β-strand	370	1	3
α-helix	374-376	3
β-strand	385	1	3
β-strand	386	1	2
α-helix	390-393	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear polyadenylated RNA-binding protein NAB2	A	protein	71	SACCHAROMYCES CEREVISIAE	P32505 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3ZJ2_1 NUCLEAR POLYADENYLATED RNA-BINDING PROTEIN NAB2 (chains A)
GSVQTGIVLCKFGALCSNPSCPFGHPTPANEDAKVIDLMWCDKNLTCDNPECRKAHSSLS
KIKEVKPISQK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Two Singular Types of Ccch Tandem Zinc Finger in Nab2P Contribute to Polyadenosine RNA Recognition. Martinez-Lumbreras, S., Santiveri, C.M., Mirassou, Y. et al. Structure (2013) 21:1800. DOI 10.1016/J.STR.2013.07.019 · PubMed

Other PDB entries of the same protein (UniProt P32505 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5L2L 1.55 Å, Nab2 Zn fingers 5-7 bound to A11G RNA
2V75 1.8 Å, N-terminal domain of Nab2
3LCN 2.0 Å, Nab2:Gfd1 complex
4JLQ 3.05 Å, Crystal structure of human Karyopherin-beta2 bound to the PY-NLS of Saccharomyces…
2JPS NAB2 N-terminal domain
2LHN RNA-binding zinc finger protein
3ZJ1 Structure of Nab2p tandem zinc finger 12

Browse structure collections

About this viewer

MolViewer shows 3ZJ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.