2LI5: Atg8-Atg7C30 complex

NMR structure of Atg8-Atg7C30 complex. Determined by solution NMR. Released 16 Nov 2011.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,226
Mol. weight: 17.45 kDa
Released: 16 Nov 2011

Explore 2LI5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LI5 contains 6 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	11-24	14
β-strand	28-31	4	1
β-strand	35	1	2
α-helix	42-44	3
β-strand	49-52	4	1
α-helix	57-67	11
β-strand	77-79	3	2
α-helix	91-94	4
β-strand	108-110	3	2

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	616-618	3
α-helix	627-629	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Autophagy-related protein 8	A	protein	117	Saccharomyces cerevisiae	P38182 (AlphaFold model)
Ubiquitin-like modifier-activating enzyme ATG7	B	protein	34	Saccharomyces cerevisiae	P38862 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LI5_1 Autophagy-related protein 8 (chains A)
HMKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQ
FVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG

Sequence of entity 2 (B), FASTA

>2LI5_2 Ubiquitin-like modifier-activating enzyme ATG7 (chains B)
GPHMISGLSVIKQEVERLGNDVFEWEDDESDEIA

Primary citation

Structural basis of Atg8 activation by a homodimeric E1, Atg7. Noda, N.N., Satoo, K., Fujioka, Y. et al. Mol Cell (2011) 44:462-475. DOI 10.1016/j.molcel.2011.08.035 · PubMed

Other PDB entries of the same protein (UniProt P38182 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WY6 1.77 Å, Crystal structure of S. cerevisiae Atg8 in complex with Ede1 (1220-1247)
3RUI 1.91 Å, Crystal structure of Atg7C-Atg8 complex
3VH3 2.0 Å, Crystal structure of Atg7CTD-Atg8 complex
5YEC 2.15 Å, Crystal structure of Atg7CTD-Atg8-MgATP complex in form II
7BRN 2.23 Å, Crystal structure of Atg40 AIM fused to Atg8
6AAG 2.44 Å, Crystal structure of budding yeast Atg8 complexed with the helical AIM of Hfl1.
3VH4 2.65 Å, Crystal structure of Atg7CTD-Atg8-MgATP complex
2ZPN 2.7 Å, The crystal structure of Saccharomyces cerevisiae Atg8- Atg19(412-415) complex
3VXW 3.0 Å, Crystal structure of Saccharomyces cerevisiae Atg8 complexed with Atg32 AIM
2KQ7 Solution structure of the Autophagy-Related Protein Atg8
2KWC The NMR structure of the autophagy-related protein Atg8

Browse structure collections

About this viewer

MolViewer shows 2LI5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.