2LPB: Complex of the central activation domain of Gcn4

Name: PDB 2LPB: Structure of the complex of the central activation domain of Gcn4 bound to the mediator co-activator domain 1 of Gal11/med15
Published: 2012-02-22
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Structure of the complex of the central activation domain of Gcn4 bound to the mediator co-activator domain 1 of Gal11/med15. Determined by solution NMR. Released 22 Feb 2012.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 947
Mol. weight: 13.47 kDa
Released: 22 Feb 2012

Explore 2LPB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LPB contains 9 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	164-170	7
α-helix	172-174	3
β-strand	177	1	1
α-helix	178-179	2
α-helix	180-183	4
β-strand	195	1	1
α-helix	196-199	4
α-helix	201-204	4
α-helix	210-232	23

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	118-121	4
α-helix	122-124	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mediator of RNA polymerase II transcription subunit 15	A	protein	81	Saccharomyces cerevisiae	P19659 (AlphaFold model)
General control protein GCN4	B	protein	34	Saccharomyces cerevisiae	P03069 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LPB_1 Mediator of RNA polymerase II transcription subunit 15 (chains A)
QRRQLTPQQQQLVNQMKVAPIPKQLLQRIPNIPPNINTWQQVTALAQQKLLTPQDMEAAK
EVYKIHQQLLFKARLQQQQAQ

Sequence of entity 2 (B), FASTA

>2LPB_2 General control protein GCN4 (chains B)
STDSTPMFEYENLEDNSKEWTSLFDNDIPVTTDD

Primary citation

The acidic transcription activator Gcn4 binds the mediator subunit Gal11/Med15 using a simple protein interface forming a fuzzy complex. Brzovic, P.S., Heikaus, C.C., Kisselev, L. et al. Mol Cell (2011) 44:942-953. DOI 10.1016/j.molcel.2011.11.008 · PubMed

Other PDB entries of the same protein (UniProt P19659 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UIO 3.3 Å, Mediator-PIC Early (Composite Model)
7UIC 3.7 Å, Mediator-PIC Early (Tail A)
7UIL 4.3 Å, Mediator-PIC Early (Tail A/B Dimer)
7UIK 7.7 Å, Mediator-PIC Early (Tail A + Upstream DNA & Activator)
2K0N Solution Structure of Yeast Gal11p kix domain
6ALY Solution structure of yeast Med15 ABD2 residues 277-368
8ZZ3 Molecular architecture of the yeast Mediator complex

Browse structure collections

About this viewer

MolViewer shows 2LPB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.