2LUE: LC3B OPTN-LIR Ptot complex structure

LC3B OPTN-LIR Ptot complex structure. Determined by solution NMR. Released 17 Jul 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,128
Mol. weight: 16.21 kDa
Released: 17 Jul 2013

Explore 2LUE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LUE contains 6 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	13-26	14
β-strand	30-37	8	1
α-helix	45-47	3
β-strand	51-55	5	1
β-strand	59	1	2
α-helix	60-71	12
β-strand	80-83	4	1
β-strand	86	1	1
β-strand	94	1	2
α-helix	95-102	8
β-strand	109-114	6	1

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	178-180	3	1
α-helix	181-182	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated proteins 1A/1B light chain 3B	A	protein	119	Homo sapiens	Q9GZQ8 (AlphaFold model)
Optineurin	B	protein	17	Homo sapiens	Q96CV9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LUE_1 Microtubule-associated proteins 1A/1B light chain 3B (chains A)
GAMGKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF

Sequence of entity 2 (B), FASTA

>2LUE_2 Optineurin (chains B)
NSSGSSEDSFVEIRMAE

Primary citation

Structural basis for phosphorylation-triggered autophagic clearance of Salmonella. Rogov, V.V., Suzuki, H., Fiskin, E. et al. Biochem J (2013) 454:459-466. DOI 10.1042/BJ20121907 · PubMed

Other PDB entries of the same protein (UniProt Q9GZQ8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8Q53 1.36 Å, Crystal structure of truncated human Microtubule-associated proteins 1A/1B light chain…
6LAN 1.41 Å, Structure of CCDC50 and LC3B complex
5D94 1.53 Å, Crystal structure of LC3-LIR peptide complex
5MS5 1.53 Å, Low-salt structure of RavZ LIR2-fused human LC3B
2ZJD 1.56 Å, Crystal Structure of LC3-p62 complex
7GAG 1.59 Å, PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with…
7GAU 1.59 Å, PanDDA analysis group deposition of ground-state model of MAP1LC3B
7ELG 1.6 Å, LC3B modificated with a covalent probe
3VTU 1.6 Å, Crystal structure of human LC3B_2-119
8Q7K 1.6 Å, IRGQ LIR2 peptide in complex with LC3B
7GAP 1.68 Å, PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with…
7GAO 1.69 Å, PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with…

Browse structure collections

About this viewer

MolViewer shows 2LUE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.