2LXA: Get5 ubiquitin-like domain

Solution structure of the Get5 ubiquitin-like domain. Determined by solution NMR. Released 21 Nov 2012.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 704
Mol. weight: 10 kDa
Released: 21 Nov 2012

Explore 2LXA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LXA contains 3 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	75-76	2	1
β-strand	77-80	4	2
β-strand	86-87	2	2
β-strand	90-91	2	1
β-strand	97	1	3
α-helix	98-107	10
β-strand	117-121	5	2
β-strand	124-125	2	2
β-strand	131	1	3
α-helix	132-135	4
α-helix	139-141	3
β-strand	143-148	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like protein MDY2	A	protein	87	Saccharomyces cerevisiae	Q12285 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LXA_1 Ubiquitin-like protein MDY2 (chains A)
MVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFL
SDLKVTPANSTITVMIKPNLEHHHHHH

Primary citation

Structures of the Sgt2/SGTA Dimerization Domain with the Get5/UBL4A UBL Domain Reveal an Interaction that Forms a Conserved Dynamic Interface. Chartron, J.W., Vandervelde, D.G., Clemons, W.M. Cell Rep (2012) 2:1620-1632. DOI 10.1016/j.celrep.2012.10.010 · PubMed

Other PDB entries of the same protein (UniProt Q12285 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VEJ 1.23 Å, Crystal structure of the Get5 carboxyl domain from S. cerevisiae
4A20 1.78 Å, Crystal structure of the Ubl domain of Mdy2 (Get5) at 1.78A
3ZDM 1.8 Å, Crystal structure of the Sgt2 N domain and the Get5 UBL domain complex
2WPV 1.99 Å, Crystal structure of S. cerevisiae Get4-Get5 complex
4GOC 2.4 Å, Crystal structure of the Get5 ubiquitin-like domain
3LKU 2.8 Å, Crystal structure of S. cerevisiae Get4 in complex with an N-terminal fragment of Get5
5BW8 2.8 Å, 2.8 A crystal structure of a Get3-Get4-Get5 intermediate complex from S.cerevisiae
9NS5 3.19 Å, Get3(D57N)-Get4/5 Complex (ATP-bound)
4PWX 5.4 Å, Crystal structure of an ATP-bound Get3-Get4-Get5 complex from S.cerevisiae
5BWK 6.0 Å, 6.0 A Crystal structure of a Get3-Get4-Get5 intermediate complex from S.cerevisiae
2LNZ Solution structure of the Get5 carboxyl domain from S. cerevisiae
2LXC Solution structure of the complex between the Sgt2 homodimerization domain and the Get5…

Browse structure collections

About this viewer

MolViewer shows 2LXA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.