4A20: Ubl domain of Mdy2

Crystal structure of the Ubl domain of Mdy2 (Get5) at 1.78A. Determined by X-ray diffraction at 1.78 Å resolution. Released 14 Nov 2012.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 1
Atoms: 688
Mol. weight: 11.4 kDa
Released: 14 Nov 2012

Explore 4A20 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4A20 contains 4 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	74-80	7	1
α-helix	85	1
β-strand	86-92	7	1
β-strand	97	1	2
α-helix	98-107	10
α-helix	114-116	3
β-strand	117-121	5	1
β-strand	124-126	3	1
β-strand	131	1	2
α-helix	132-134	3
β-strand	138	1	3
β-strand	141	1	3
β-strand	143-148	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like protein MDY2	A	protein	98	SACCHAROMYCES CEREVISIAE	Q12285 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4A20_1 UBIQUITIN-LIKE PROTEIN MDY2 (chains A)
MAHHHHHHVDDDDKMDNAAVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHI
SEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNP

Primary citation

Structure of the Sgt2/Get5 Complex Provides Insights Into Get-Mediated Targeting of Tail-Anchored Membrane Proteins. Simon, A.C., Simpson, P.J., Goldstone, R.M. et al. Proc Natl Acad Sci U S A (2013) 110:1327. DOI 10.1073/PNAS.1207518110 · PubMed

Other PDB entries of the same protein (UniProt Q12285 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VEJ 1.23 Å, Crystal structure of the Get5 carboxyl domain from S. cerevisiae
3ZDM 1.8 Å, Crystal structure of the Sgt2 N domain and the Get5 UBL domain complex
2WPV 1.99 Å, Crystal structure of S. cerevisiae Get4-Get5 complex
4GOC 2.4 Å, Crystal structure of the Get5 ubiquitin-like domain
3LKU 2.8 Å, Crystal structure of S. cerevisiae Get4 in complex with an N-terminal fragment of Get5
5BW8 2.8 Å, 2.8 A crystal structure of a Get3-Get4-Get5 intermediate complex from S.cerevisiae
9NS5 3.19 Å, Get3(D57N)-Get4/5 Complex (ATP-bound)
4PWX 5.4 Å, Crystal structure of an ATP-bound Get3-Get4-Get5 complex from S.cerevisiae
5BWK 6.0 Å, 6.0 A Crystal structure of a Get3-Get4-Get5 intermediate complex from S.cerevisiae
2LNZ Solution structure of the Get5 carboxyl domain from S. cerevisiae
2LXA Solution structure of the Get5 ubiquitin-like domain
2LXC Solution structure of the complex between the Sgt2 homodimerization domain and the Get5…

Browse structure collections

About this viewer

MolViewer shows 4A20 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.