2M09: Splicing factor 1

Structure, phosphorylation and U2AF65 binding of the Nterminal Domain of splicing factor 1 during 3 splice site Recognition. Determined by solution NMR. Released 30 Jan 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 969
Mol. weight: 13.82 kDa
Released: 30 Jan 2013

Explore 2M09 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M09 contains 8 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	30-32	3
α-helix	40-41	2
α-helix	46-67	22
α-helix	73-75	3
α-helix	76-79	4
α-helix	86	1
β-strand	87	1	1
α-helix	88	1
β-strand	93	1	1
α-helix	97-119	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Splicing factor 1	A	protein	121	Homo sapiens	Q15637 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M09_1 Splicing factor 1 (chains A)
GAMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPE
PIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQ
D

Primary citation

Structure, phosphorylation and U2AF65 binding of the N-terminal domain of splicing factor 1 during 3'-splice site recognition. Zhang, Y., Madl, T., Bagdiul, I. et al. Nucleic Acids Res (2013) 41:1343-1354. DOI 10.1093/nar/gks1097 · PubMed

Other PDB entries of the same protein (UniProt Q15637 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FXW 2.29 Å, Structure of phosphorylated SF1 complex with U2AF65-UHM domain
4FXX 2.48 Å, Structure of SF1 coiled-coil domain
7VPX 3.0 Å, The cryo-EM structure of the human pre-A complex
1K1G Structural basis for recognition of the intron branch site RNA by splicing factor 1
1O0P Solution Structure of the third RNA Recognition Motif (RRM) of U2AF65 in complex with an…
1OPI Solution structure of the third RNA recognition motif (RRM) of U2AF65 in complex with an…
2M0G Structure, phosphorylation and U2AF65 binding of the Nterminal Domain of splicing factor…
7VH9 Solution structure of the chimeric peptide of the first SURP domain of Human SF3A1 and…
8PXX Structure of the WW domain tandem of PRPF40A in complex with SF1

Browse structure collections

About this viewer

MolViewer shows 2M09 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.