2M3O: E3 ubiquitin-protein ligase NEDD4

Structure and dynamics of a human Nedd4 WW domain-ENaC complex. Determined by solution NMR. Released 28 Aug 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 425
Mol. weight: 6.03 kDa
Released: 28 Aug 2013

Explore 2M3O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M3O contains 2 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain P: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	640-643	4
α-helix	644-647	4

Chain W: 0 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	420	1	1
β-strand	422	1	1
β-strand	427-431	5	2
β-strand	437-441	5	2
β-strand	446-448	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase NEDD4	W	protein	43	Homo sapiens	P46934 (AlphaFold model)
Amiloride-sensitive sodium channel subunit alpha	P	protein	11	Homo sapiens	P37088 (AlphaFold model)

Sequence of entity 1 (W), FASTA

>2M3O_1 E3 ubiquitin-protein ligase NEDD4 (chains W)
GSMEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPA

Sequence of entity 2 (P), FASTA

>2M3O_2 Amiloride-sensitive sodium channel subunit alpha (chains P)
TAPPPAYATLG

Primary citation

Structure and dynamics of human Nedd4-1 WW3 in complex with the alpha ENaC PY motif. Bobby, R., Medini, K., Neudecker, P. et al. Biochim Biophys Acta (2013) 1834:1632-1641. DOI 10.1016/j.bbapap.2013.04.031 · PubMed

Other PDB entries of the same protein (UniProt P46934 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N7F 1.1 Å, Crystal structure of 3rd WW domain of human Nedd4-1
4N7H 1.7 Å, Crystal Structure of the Complex of 3rd WW domain of Human Nedd4 and 1st PPXY Motif of…
3B7Y 1.8 Å, Crystal structure of the C2 Domain of the E3 Ubiquitin-Protein Ligase NEDD4
9H9O 2.12 Å, Crystal structure of NEDD4 HECT domain in complex with norclomipramine
9H9T 2.17 Å, Crystal structure of NEDD4 HECT domain in complex with covalent inhibitor
5C91 2.44 Å, NEDD4 HECT with covalently bound indole-based inhibitor
2XBF 2.5 Å, Nedd4 HECT structure
4BBN 2.51 Å, NEDD4 HECT-Ub:Ub complex
2XBB 2.68 Å, Nedd4 HECT:Ub complex
4BE8 3.0 Å, NEDD4 HECT A889F structure
5C7J 3.0 Å, Crystal structure of NEDD4 with a ub variant
2KPZ Human NEDD4 3RD WW Domain Complex with The Human T-cell Leukemia virus 1 GAG-Pro…

Browse structure collections

About this viewer

MolViewer shows 2M3O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.