Structure of a Conserved Golgi Complex-targeting Signal in Coronavirus Envelope Proteins. Determined by solution NMR. Released 2 Apr 2014.
Explore 2MM4 in 3D Show helices and sheets RCSB PDB PDBe
2MM4 contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 14-42 | 29 | |
| α-helix | 56-64 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Envelope small membrane protein | A | protein | 58 | SARS coronavirus | P59637 (AlphaFold model) |
>2MM4_1 Envelope small membrane protein (chains A) ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLAAYAANIVNVSLVKPTVYVYSRVKNL
Structure of a conserved Golgi complex-targeting signal in coronavirus envelope proteins. Li, Y., Surya, W., Claudine, S. et al. J Biol Chem (2014) 289:12535-12549. DOI 10.1074/jbc.M114.560094 · PubMed
Other PDB entries of the same protein (UniProt P59637 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2MM4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.