5X29: Envelope small membrane protein

NMR structure of the SARS Coronavirus E protein pentameric ion channel. Determined by solution NMR. Released 7 Jun 2017.

Method: Solution NMR
Organism: Human SARS coronavirus
Chains: 5
Atoms: 2,235
Mol. weight: 45.02 kDa
Released: 7 Jun 2017

Explore 5X29 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5X29 contains 26 α-helices and 0 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	12-15	4
α-helix	17-20	4
α-helix	26-36	11
α-helix	40-47	8
α-helix	54-58	5
α-helix	59-62	4

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	14-36	23
α-helix	40-47	8
α-helix	54-58	5
α-helix	59-62	4

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	13-15	3
α-helix	17-24	8
α-helix	27-34	8
α-helix	40-47	8
α-helix	54-58	5

Chain D: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	12-15	4
α-helix	17-24	8
α-helix	26-34	9
α-helix	40-47	8
α-helix	54-58	5

Chain E: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	12-15	4
α-helix	17-24	8
α-helix	27-36	10
α-helix	40-47	8
α-helix	54-58	5
α-helix	59-62	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Envelope small membrane protein	A, B, C, D, E	protein	81	Human SARS coronavirus	P59637 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>5X29_1 Envelope small membrane protein (chains A, B, C, D, E)
MHHHHHHSSGVDLGTENLYFQSMETGTLIVNSVLLFLAFVVFLLVTLAILTALRLAAYAA
NIVNVSLVKPTVYVYSRVKNL

Primary citation

Structural model of the SARS coronavirus E channel in LMPG micelles. Surya, W., Li, Y., Torres, J. Biochim Biophys Acta (2018) 1860:1309-1317. DOI 10.1016/j.bbamem.2018.02.017 · PubMed

Other PDB entries of the same protein (UniProt P59637 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NTJ 1.74 Å, PALS1 PDZ1 domain with SARS-CoV-1_E PBM complex
2MM4 Structure of a Conserved Golgi Complex-targeting Signal in Coronavirus Envelope Proteins
5XER TK9 NMR structure in DPC micelle
5XES TK9 NMR structure in SDS micelle

Browse structure collections

About this viewer

MolViewer shows 5X29 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.