2MOX: Sorbin and SH3 domain-containing protein 1

solution structure of tandem SH3 domain of Sorbin and SH3 domain-containing protein 1. Determined by solution NMR. Released 28 May 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,177
Mol. weight: 16.66 kDa
Released: 28 May 2014

Explore 2MOX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MOX contains 4 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	793-795	3
β-strand	796-800	5	1
β-strand	804	1	2
β-strand	814	1	2
β-strand	819-824	6	1
β-strand	830-835	6	1
β-strand	838-843	6	1
α-helix	844-846	3
β-strand	847-849	3	1
α-helix	851-853	3
β-strand	870-874	5	3
β-strand	878	1	4
β-strand	888	1	4
β-strand	893-899	7	3
β-strand	904-908	5	3
β-strand	915-919	5	3
α-helix	920-922	3
β-strand	923-927	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorbin and SH3 domain-containing protein 1	A	protein	143	Homo sapiens	Q9BX66 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MOX_1 Sorbin and SH3 domain-containing protein 1 (chains A)
QHMSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYI
ELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEG
RIPGTSRQGIFPITYVDVIKRPL

Primary citation

Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin. Zhao, D., Wang, X., Peng, J. et al. J Struct Biol (2014) 187:194-205. DOI 10.1016/j.jsb.2014.05.009 · PubMed

Other PDB entries of the same protein (UniProt Q9BX66 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2O9S 0.83 Å, The second SH3 domain from ponsin
4LN2 1.0 Å, The second SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
4LNP 1.41 Å, The first SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
2O31 1.5 Å, Crystal structure of the second SH3 domain from ponsin
2O9V 1.63 Å, The second SH3 domain from Ponsin in complex with the paxillin proline rich region
2DL3 Solution structure of the first SH3 domain of human sorbin and Sh3 domain-containing…
2ECZ Solution structure of the SH3 domain of Sorbin and SH3 domain-containing protein 1
2LJ0 The third SH3 domain of R85FL
2LJ1 The third SH3 domain of R85FL with ataxin-7 PRR
2O2W Extending powder diffraction to proteins: structure solution of the second SH3 domain…

Browse structure collections

About this viewer

MolViewer shows 2MOX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.