2MQ0: Myosin-binding protein C, cardiac-type

NMR structure of the c3 domain of human cardiac myosin binding protein-c. Determined by solution NMR. Released 30 Jul 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 758
Mol. weight: 10.83 kDa
Released: 30 Jul 2014

Explore 2MQ0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MQ0 contains 2 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	456	1	1
α-helix	459-461	3
β-strand	465-466	2	2
β-strand	467	1	3
β-strand	471-472	2	4
β-strand	475-476	2	4
β-strand	477	1	1
β-strand	486-488	3	5
β-strand	491-492	2	5
α-helix	493-494	2
β-strand	501-506	6	4
β-strand	509-514	6	4
β-strand	517	1	3
β-strand	524-528	5	5
β-strand	533-537	5	5
β-strand	540-541	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-binding protein C, cardiac-type	A	protein	95	Homo sapiens	Q14896 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MQ0_1 Myosin-binding protein C, cardiac-type (chains A)
GSHMPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQ
RHHLIINEAMLEDAGHYALCTSGGQALAELIVQEK

Primary citation

Structural Characterization of the C3 Domain of Cardiac Myosin Binding Protein C and Its Hypertrophic Cardiomyopathy-Related R502W Mutant. Zhang, X.L., De, S., McIntosh, L.P. et al. Biochemistry (2014) 53:5332-5342. DOI 10.1021/bi500784g · PubMed

Other PDB entries of the same protein (UniProt Q14896 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CX2 1.3 Å, Crystal structure of the C1 domain of cardiac isoform of myosin binding protein-C at 1.3A
2V6H 1.55 Å, Crystal structure of the C1 domain of cardiac myosin binding protein-C
7LRG 6.1 Å, Filamentous actin decorated with human cardiac myosin binding protein C C2 domain
8G4L 6.4 Å, Cryo-EM structure of the human cardiac myosin filament
7TIJ 8.0 Å, Cardiac F-actin decorated with regulatory M-domain of cardiac myosin binding protein C
7TIT 8.0 Å, Cardiac thin filament decorated with regulatory M-domain of cardiac myosin binding…
7TJ7 8.0 Å, Cardiac thin filament decorated with C1 Ig-domain and regulatory M-domain of cardiac…
6G2T 9.0 Å, human cardiac myosin binding protein C C1 Ig-domain bound to native cardiac thin filament
6CXI 11.0 Å, Cardiac thin filament decorated with C0C1 fragment of cardiac myosin binding protein C…
6CXJ 11.0 Å, Cardiac thin filament decorated with C0C1 fragment of cardiac myosin binding protein C…
1GXE Central domain of cardiac myosin binding protein C
1PD6 The NMR structure of domain C2 of human cardiac Myosin Binding Protein C

Browse structure collections

About this viewer

MolViewer shows 2MQ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.