2N0K: Alpha-crystallin B chain

Chemical shift assignments and structure of the alpha-crystallin domain from human, HSPB5. Determined by solution NMR. Released 3 Jun 2015.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,436
Mol. weight: 20.4 kDa
Released: 3 Jun 2015

Explore 2N0K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N0K contains 4 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	68-71	4	1
β-strand	74-77	4	1
β-strand	78-80	3	2
β-strand	90-93	4	3
β-strand	97-101	5	3
β-strand	103-108	6	4
β-strand	113-117	5	4
β-strand	120-123	4	3
α-helix	124-125	2
β-strand	128	1	5
α-helix	130-132	3
β-strand	134	1	6
β-strand	137	1	2
β-strand	142-144	3	2
β-strand	146	1	6
β-strand	147-148	2	1
β-strand	149	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-crystallin B chain	A, B	protein	89	Homo sapiens	P02511 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2N0K_1 Alpha-crystallin B chain (chains A, B)
GLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYR
IPADVDPLTITSSLSSDGVLTVDGPRKQV

Primary citation

A conserved histidine modulates HSPB5 structure to trigger chaperone activity in response to stress-related acidosis. Rajagopal, P., Tse, E., Borst, A.J. et al. Elife (2015) 4. DOI 10.7554/eLife.07304 · PubMed

Other PDB entries of the same protein (UniProt P02511 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4M5S 1.37 Å, Human alphaB crystallin core domain in complex with C-terminal peptide
3SGP 1.4 Å, Amyloid-related segment of alphaB-crystallin residues 90-100 mutant V91L
7ROJ 1.6 Å, Amyloid-related segment of alphaB-crystallin residues 90-100 with G95W mutation
3SGM 1.7 Å, Bromoderivative-2 of amyloid-related segment of alphaB-crystallin residues 90-100
3SGS 1.7 Å, Amyloid-related segment of alphaB-crystallin residues 95-100
2Y1Y 2.0 Å, Human alphaB crystallin ACD(residues 71-157)
4M5T 2.0 Å, Disulfide trapped human alphaB crystallin core domain in complex with C-terminal peptide
3SGR 2.17 Å, Tandem repeat of amyloid-related segment of alphaB-crystallin residues 90-100 mutant V91L
2Y1Z 2.5 Å, Human alphaB Crystallin ACD R120G
3SGO 2.56 Å, Amyloid-related segment of alphaB-crystallin residues 90-100
2WJ7 2.63 Å, human alphaB crystallin
5VVV 2.8 Å, Structural Investigations of the Substrate Specificity of Human O-GlcNAcase

Browse structure collections

About this viewer

MolViewer shows 2N0K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.