Solution structure of human Myosin VI isoform3 (1050-1131). Determined by solution NMR. Released 2 Mar 2016.
Explore 2N12 in 3D Show helices and sheets RCSB PDB PDBe
2N12 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 63-76 | 14 | |
| α-helix | 99-107 | 9 | |
| α-helix | 112-137 | 26 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Unconventional myosin-VI | A | protein | 82 | Homo sapiens | Q9UM54 (AlphaFold model) |
>2N12_1 Unconventional myosin-VI (chains A) RPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAA CREEFHRRLKVYHAWKSKNKKR
Diverse functions of myosin VI elucidated by an isoform-specific alpha-helix domain. Wollscheid, H.P., Biancospino, M., He, F. et al. Nat Struct Mol Biol (2016) 23:300-308. DOI 10.1038/nsmb.3187 · PubMed
Other PDB entries of the same protein (UniProt Q9UM54 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2N12 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.