2N1W: Human SUMO2

Solution structure of human SUMO2. Determined by solution NMR. Released 20 Apr 2016.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 742
Mol. weight: 12.24 kDa
Released: 20 Apr 2016

Explore 2N1W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N1W contains 1 α-helix and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	17-24	8	1
β-strand	29-35	7	1
α-helix	41-51	11
β-strand	58-62	5	1
β-strand	65-66	2	1
β-strand	82-88	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small ubiquitin-related modifier 2	A	protein	107	Homo sapiens	P61956 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2N1W_1 Small ubiquitin-related modifier 2 (chains A)
MGSSHHHHHHSQDPMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKA
YCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG

Primary citation

Structures of human SUMO. Naik, M.T., Naik, N., Shih, H. et al. To be published.

Other PDB entries of the same protein (UniProt P61956 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WM3 1.2 Å, Crystal structure of human SUMO-2 protein
1WM2 1.6 Å, Crystal structure of human SUMO-2 protein
4NPN 1.63 Å, Crystal structure of human tetra-SUMO-2
7P99 1.8 Å, Structure of human USPL1 in complex with SUMO2
2D07 2.1 Å, Crystal Structure of SUMO-3-modified Thymine-DNA Glycosylase
4BKG 2.11 Å, crystal structure of human diSUMO-2
3ZO5 2.15 Å, Structure of SENP2-Loop1 in complex with preSUMO-2
2IO0 2.3 Å, Crystal structure of human Senp2 in complex with preSUMO-2
5ELU 2.35 Å, Isoform-specific inhibition of SUMO-dependent protein-protein interactions
5D2M 2.4 Å, Complex between human SUMO2-RANGAP1, UBC9 and ZNF451
7ZJV 2.4 Å, Structure of human USPL1 in covalent complex with DeltaN-SUMO2/3-PA probe
5EQL 2.49 Å, Isoform-specific inhibition of SUMO-dependent protein-protein interactions

Browse structure collections

About this viewer

MolViewer shows 2N1W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.