2N74: Non-structural protein 1

Solution Structure of the RNA-Binding domain of non-structural protein 1 from the 1918 H1N1 influenza virus. Determined by solution NMR. Released 30 Sept 2015.

Method: Solution NMR
Organism: Influenza A virus
Chains: 2
Atoms: 1,178
Mol. weight: 16.82 kDa
Released: 30 Sept 2015

Explore 2N74 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N74 contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	4-23	20
α-helix	31-50	20
α-helix	54-71	18

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	104-123	20
α-helix	131-150	20
α-helix	154-171	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein 1	A, B	protein	73	Influenza A virus	Q99AU3

Sequence of entity 1 (A, B), FASTA

>2N74_1 Non-structural protein 1 (chains A, B)
MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRA
GKQIVERILKEES

Primary citation

Structural Basis for a Novel Interaction between the NS1 Protein Derived from the 1918 Influenza Virus and RIG-I. Jureka, A.S., Kleinpeter, A.B., Cornilescu, G. et al. Structure (2015) 23:2001-2010. DOI 10.1016/j.str.2015.08.007 · PubMed

Other PDB entries of the same protein (UniProt Q99AU3), best resolution first:

5UL6 1.45 Å, The molecular mechanisms by which NS1 of the 1918 Spanish influenza A virus hijack host…
6ATV 1.75 Å, The molecular mechanisms by which NS1 of the 1918 Spanish influenza A virus hijack host…
6DGK 1.9 Å, Crystal Structure of the Non-Structural Protein 1 (NS1) effector domain W187A mutant…
6OX7 2.75 Å, The complex of 1918 NS1-ED and the iSH2 domain of the human p85beta subunit of PI3K
6U28 2.95 Å, Crystal structure of 1918 NS1-ED W187A in complex with the p85-beta-iSH2 domain of human…
6NU0 Solution NMR structure of 1918 NS1 effector domain

Browse structure collections

About this viewer

MolViewer shows 2N74 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.