2N7I: Prolactin receptor transmembrane domain
NMR structure of the prolactin receptor transmembrane domain. Determined by solution NMR. Released 18 May 2016.
- Method
- Solution NMR
- Organism
- Homo sapiens
- Chains
- 1
- Atoms
- 277
- Mol. weight
- 3.96 kDa
- Released
- 18 May 2016
Explore 2N7I in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2N7I contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 210-230 | 21 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Prolactin receptor | A | protein | 37 | Homo sapiens | P16471 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>2N7I_1 Prolactin receptor (chains A)
GSFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMV
Primary citation
A combined computational and structural model of the full-length human prolactin receptor. Bugge, K., Papaleo, E., Haxholm, G.W. et al. Nat Commun (2016) 7:11578-11578. DOI 10.1038/ncomms11578 · PubMed
Other PDB entries of the same protein (UniProt P16471 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3N06 2.0 Å, A mutant human Prolactin receptor antagonist H27A in complex with the extracellular…
- 3NCE 2.0 Å, A mutant human Prolactin receptor antagonist H27A in complex with the mutant…
- 3MZG 2.1 Å, Crystal structure of a human prolactin receptor antagonist in complex with the…
- 3N0P 2.1 Å, A mutant human Prolactin receptor antagonist H30A in complex with the extracellular…
- 3NCB 2.1 Å, A mutant human Prolactin receptor antagonist H180A in complex with the extracellular…
- 3D48 2.5 Å, Crystal structure of a prolactin receptor antagonist bound to the extracellular domain…
- 3NCC 2.5 Å, A human Prolactin receptor antagonist in complex with the mutant extracellular domain…
- 3NCF 2.8 Å, A mutant human Prolactin receptor antagonist H30A in complex with the mutant…
- 1BP3 2.9 Å, The xray structure of a growth hormone-prolactin receptor complex
- 4I18 3.24 Å, Crystal structure of human prolactin receptor complexed with Fab fragment
- 2LFG Solution structure of the human prolactin receptor ecd domain d2
Browse structure collections
About this viewer
MolViewer shows 2N7I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.