2NS2: Spindlin1

Name: PDB 2NS2: Crystal Structure of Spindlin1
Published: 2006-11-28
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cell cycle

Crystal Structure of Spindlin1. Determined by X-ray diffraction at 2.2 Å resolution. Released 28 Nov 2006.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,274
Mol. weight: 55.24 kDa
Ligands: PO4
Released: 28 Nov 2006

Explore 2NS2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NS2 contains 7 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	32-37	6	1
α-helix	43-44	2
β-strand	45-54	10	1
β-strand	62-66	5	1
β-strand	71	1	2
β-strand	73-75	3	1
β-strand	83-89	7	1
α-helix	91-92	2
α-helix	101-107	7
β-strand	111-117	7	2
β-strand	123-133	11	2
α-helix	134	1
β-strand	141-145	5	2
β-strand	148-149	2	2
β-strand	150	1	3
β-strand	151-154	4	2
α-helix	156-161	6
β-strand	165-168	4	2
β-strand	192-196	5	3
α-helix	201	1
β-strand	202-210	9	3
β-strand	217-222	6	3
β-strand	227	1	1
β-strand	228-232	5	3

Chain B: 1 helix, 18 β-strands

Element	Residues	Length	Sheet
β-strand	32-37	6	3
β-strand	44-54	11	3
β-strand	62-66	5	3
β-strand	71	1	4
β-strand	73-75	3	3
β-strand	83-88	6	3
β-strand	111-114	4	4
β-strand	126-133	8	4
β-strand	141-145	5	4
β-strand	148-149	2	4
β-strand	150	1	5
β-strand	151-154	4	4
α-helix	157-161	5
β-strand	166	1	4
β-strand	192-196	5	5
β-strand	202-210	9	5
β-strand	217-222	6	5
β-strand	227	1	3
β-strand	229-232	4	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spindlin-1	A, B	protein	242	Homo sapiens	Q9Y657 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2NS2_1 Spindlin-1 (chains A, B)
GPLGSMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQV
PVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHM
FETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSP
PAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVK
TS

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2

Primary citation

Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation. Zhao, Q., Qin, L., Jiang, F. et al. J Biol Chem (2007) 282:647-656. DOI 10.1074/jbc.M604029200 · PubMed

Other PDB entries of the same protein (UniProt Q9Y657 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OCB 1.42 Å, Crystal structure of Spindlin1 in complex with the inhibitor XY49-92B
6I8Y 1.52 Å, Crystal structure of Spindlin1 in complex with the Methyltransferase inhibitor A366
6I8L 1.58 Å, Crystal structure of Spindlin1 in complex with the inhibitor TD001851a
6QPL 1.6 Å, Crystal structure of Spindlin1 in complex with the inhibitor MS31
7CNA 1.6 Å, Crystal structure of Spindlin1/C11orf84 complex bound to histone H3K4me3K9me3 peptide
4MZG 1.7 Å, Crystal structure of human Spindlin1 bound to histone H3K4me3 peptide
6I8B 1.76 Å, Crystal structure of Spindlin1 in complex with the inhibitor VinSpinIn
8GTX 1.8 Å, Crystal Structure of human Spindlin1-HBx complex
9T2Z 1.87 Å, Spindlin 1 with crystallization epitope mutations H127D:L128D:T131R
4H75 2.1 Å, Crystal structure of human Spindlin1 in complex with a histone H3K4(me3) peptide
4MZF 2.1 Å, Crystal structure of human Spindlin1 bound to histone H3(K4me3-R8me2a) peptide
4MZH 2.2 Å, Crystal structure of human Spindlin1 bound to histone H3(K4me3-R8me2s) peptide

Browse structure collections

About this viewer

MolViewer shows 2NS2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.