2OEX: ALIX/AIP1 V Domain

Structure of ALIX/AIP1 V Domain. Determined by X-ray diffraction at 2.58 Å resolution. Released 27 Mar 2007.

Method: X-ray diffraction
Resolution: 2.58 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,489
Mol. weight: 79.34 kDa
Released: 27 Mar 2007

Explore 2OEX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OEX contains 27 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	363-399	37
α-helix	403-406	4
α-helix	415-426	12
α-helix	429-471	43
α-helix	473-477	5
α-helix	479-480	2
α-helix	481-484	4
α-helix	486-524	39
α-helix	527-533	7
α-helix	547-575	29
α-helix	580-591	12
α-helix	596-637	42
α-helix	644-700	57

Chain B: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	363-398	36
α-helix	403-406	4
α-helix	415-426	12
α-helix	430-471	42
α-helix	479-480	2
α-helix	481-484	4
α-helix	486-514	29
α-helix	517-523	7
α-helix	527-531	5
α-helix	547-574	28
α-helix	580-590	11
α-helix	596-607	12
α-helix	609-636	28
α-helix	644-700	57

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Programmed cell death 6-interacting protein	A, B	protein	351	Homo sapiens	Q8WUM4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2OEX_1 Programmed cell death 6-interacting protein (chains A, B)
GIDPFTHMPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGD
TVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAK
FKERWQRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELN
AAIPSANPAKTMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQD
GVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREE
VLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTER

Primary citation

Structural and Biochemical Studies of ALIX/AIP1 and Its Role in Retrovirus Budding. Fisher, R.D., Chung, H.Y., Zhai, Q. et al. Cell (2007) 128:841-852. DOI 10.1016/j.cell.2007.01.035 · PubMed

Other PDB entries of the same protein (UniProt Q8WUM4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WA1 1.87 Å, CHMP4C A232T in complex with ALIX BRO1
5V3R 1.91 Å, CHMP4C in complex with ALIX BRO1
3E1R 2.0 Å, Midbody targeting of the ESCRT machinery by a non-canonical coiled-coil in CEP55
3C3R 2.02 Å, ALIX BRO1 CHMP4C complex
3C3Q 2.1 Å, ALIX Bro1-domain:CHMIP4B co-crystal structure
3C3O 2.15 Å, ALIX Bro1-domain:CHMIP4A co-crystal structure
2ZNE 2.2 Å, Crystal structure of Zn2+-bound form of des3-23ALG-2 complexed with Alix ABS peptide
6KP3 2.2 Å, Structure of sendai virus Y3/ALIX-BRO1 domain complex
2XS1 2.3 Å, Crystal Structure of ALIX in complex with the SIVmac239 PYKEVTEDL Late Domain
2XS8 2.5 Å, Crystal Structure of ALIX in complex with the SIVagmTan-1 AYDPARKLL Late Domain
2OEW 2.55 Å, Structure of ALIX/AIP1 Bro1 Domain
2R05 2.55 Å, Crystal Structure of ALIX/AIP1 in complex with the HIV-1 YPLASL Late Domain

Browse structure collections

About this viewer

MolViewer shows 2OEX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.