ALIX Bro1-domain:CHMIP4A co-crystal structure. Determined by X-ray diffraction at 2.15 Å resolution. Released 10 Jun 2008.
Explore 3C3O in 3D Show helices and sheets RCSB PDB PDBe
3C3O contains 17 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-11 | 4 | |
| β-strand | 12 | 1 | 1 |
| α-helix | 18-22 | 5 | |
| α-helix | 42-55 | 14 | |
| α-helix | 57-58 | 2 | |
| α-helix | 62-76 | 15 | |
| β-strand | 93-96 | 4 | 1 |
| β-strand | 110-113 | 4 | 1 |
| α-helix | 116-135 | 20 | |
| α-helix | 143-171 | 29 | |
| α-helix | 174-176 | 3 | |
| α-helix | 181-205 | 25 | |
| α-helix | 210-230 | 21 | |
| α-helix | 241-266 | 26 | |
| α-helix | 270-290 | 21 | |
| α-helix | 298-314 | 17 | |
| α-helix | 315-319 | 5 | |
| α-helix | 326-328 | 3 | |
| α-helix | 330-332 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 212-218 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Programmed cell death 6-interacting protein | A | protein | 380 | Homo sapiens | Q8WUM4 (AlphaFold model) |
| Charged multivesicular body protein 4a peptide | B | protein | 13 | Q9BY43 (AlphaFold model) |
>3C3O_1 Programmed cell death 6-interacting protein (chains A) MHHHHHHHHHHSGQNLYFQGHMATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQY CRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAF DKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGA FLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQ AADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQH AAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVK STPVNVPISQKFTDLFEKMV
>3C3O_2 Charged multivesicular body protein 4a peptide (chains B) DEEALKQLAEWVS
ALIX-CHMP4 interactions in the human ESCRT pathway. McCullough, J., Fisher, R.D., Whitby, F.G. et al. Proc Natl Acad Sci U S A (2008) 105:7687-7691. DOI 10.1073/pnas.0801567105 · PubMed
Other PDB entries of the same protein (UniProt Q8WUM4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3C3O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.