2R05: ALIX/AIP1

Crystal Structure of ALIX/AIP1 in complex with the HIV-1 YPLASL Late Domain. Determined by X-ray diffraction at 2.55 Å resolution. Released 18 Dec 2007.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,591
Mol. weight: 79.34 kDa
Released: 18 Dec 2007

Explore 2R05 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2R05 contains 32 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
β-strand	12	1	1
α-helix	18-28	11
α-helix	34-54	21
α-helix	62-78	17
β-strand	93-96	4	1
β-strand	110-113	4	1
α-helix	116-136	21
α-helix	143-164	22
α-helix	167-170	4
α-helix	174-176	3
α-helix	177-179	3
α-helix	181-205	25
α-helix	210-232	23
α-helix	241-266	26
α-helix	270-291	22
α-helix	298-314	17
α-helix	315-319	5
α-helix	321-325	5
α-helix	326-328	3
α-helix	330-332	3
α-helix	340-343	4
α-helix	359-360	2
α-helix	361-397	37
α-helix	404-406	3
β-strand	410	1	2
α-helix	415-426	12
α-helix	430-471	42
α-helix	481-523	43
α-helix	527-533	7
α-helix	535-536	2
β-strand	537	1	2
α-helix	547-575	29
α-helix	581-590	10
α-helix	596-639	44
α-helix	644-697	54

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	38-42	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Programmed cell death 6-interacting protein	A	protein	697	Homo sapiens	Q8WUM4 (AlphaFold model)
p6-Gag	B	protein	11		P35962

Sequence of entity 1 (A), FASTA

>2R05_1 Programmed cell death 6-interacting protein (chains A)
ATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKH
EGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKS
CVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISP
DTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEV
FPVLAAKHCIMQANAEYHQSILAKQQYYFGEEIARLQHAAELIKTVASRYDEYVNVKDFS
DKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPV
SVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKS
RSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPS
NELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAK
TMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSV
TELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEVLKNLATAYD
NFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFAR

Sequence of entity 2 (B), FASTA

>2R05_2 p6-Gag (chains B)
ELYPLASLRSL

Primary citation

Structural and functional studies of ALIX interactions with YPX(n)L late domains of HIV-1 and EIAV. Zhai, Q., Fisher, R.D., Chung, H.Y. et al. Nat Struct Mol Biol (2008) 15:43-49. DOI 10.1038/nsmb1319 · PubMed

Other PDB entries of the same protein (UniProt Q8WUM4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WA1 1.87 Å, CHMP4C A232T in complex with ALIX BRO1
5V3R 1.91 Å, CHMP4C in complex with ALIX BRO1
3E1R 2.0 Å, Midbody targeting of the ESCRT machinery by a non-canonical coiled-coil in CEP55
3C3R 2.02 Å, ALIX BRO1 CHMP4C complex
3C3Q 2.1 Å, ALIX Bro1-domain:CHMIP4B co-crystal structure
3C3O 2.15 Å, ALIX Bro1-domain:CHMIP4A co-crystal structure
2ZNE 2.2 Å, Crystal structure of Zn2+-bound form of des3-23ALG-2 complexed with Alix ABS peptide
6KP3 2.2 Å, Structure of sendai virus Y3/ALIX-BRO1 domain complex
2XS1 2.3 Å, Crystal Structure of ALIX in complex with the SIVmac239 PYKEVTEDL Late Domain
2XS8 2.5 Å, Crystal Structure of ALIX in complex with the SIVagmTan-1 AYDPARKLL Late Domain
2OEW 2.55 Å, Structure of ALIX/AIP1 Bro1 Domain
2OEX 2.58 Å, Structure of ALIX/AIP1 V Domain

Browse structure collections

About this viewer

MolViewer shows 2R05 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.