2OGP: Second PDZ domain of Par-3

Solution structure of the second PDZ domain of Par-3. Determined by solution NMR. Released 25 Dec 2007.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 1
Atoms: 733
Mol. weight: 10.47 kDa
Released: 25 Dec 2007

Explore 2OGP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OGP contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	21-28	8	1
β-strand	36-40	5	1
β-strand	51-56	6	1
α-helix	61-65	5
β-strand	72-77	6	1
β-strand	80-81	2	1
α-helix	87-96	10
β-strand	102-109	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Partitioning-defective 3 homolog	A	protein	97	Rattus norvegicus	Q9Z340 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2OGP_1 Partitioning-defective 3 homolog (chains A)
KRVGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIE
VNGVDLAGKSQEEVVSLLRSTKMEGTVSLLVFRQEEA

Primary citation

PDZ domains of par-3 as potential phosphoinositide signaling integrators. Wu, H., Feng, W., Chen, J. et al. Mol Cell (2007) 28:886-898. DOI 10.1016/j.molcel.2007.10.028 · PubMed

Other PDB entries of the same protein (UniProt Q9Z340 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JUE 1.55 Å, The complex of PDZ and PBM
4DC2 2.4 Å, Structure of PKC in Complex with a Substrate Peptide from Par-3
9IMP 2.87 Å, The complex of PDZ3 and PBM
4I6P 2.9 Å, Crystal structure of Par3-NTD domain
3ZEE 6.1 Å, Electron cyro-microscopy helical reconstruction of Par-3 N terminal domain
2K1Z Solution structure of Par-3 PDZ3
2K20 Solution structure of Par-3 PDZ3 in complex with PTEN peptide
2NS5 The conserved N-terminal domain of Par-3 adopts a novel PB1-like structure required for…

Browse structure collections

About this viewer

MolViewer shows 2OGP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.